Products: Primary Antibodies

Anti-BAF53a (N336B/83)


 Download Full Datasheet

PRODUCT OPTIONS

Catalog # Option Volume Concentration Price*
Catalog #
75-330
Option
Purified
Volume
100 µL
Concentration
1 mg/mL
Price
$205.00
Catalog #
73-330
Option
TC Supernatant
Volume
5 mL
Concentration
Lot dependent
Price
$180.00

Overview

Brand:

NeuroMab

Antibody Type:

Monoclonal

Host Species:

Mouse

Antibody Isotype:

IgG2b

Species Reactivity:

Human Mouse Rat

Applications:
WB Western Blot
IHC Immunohistochemistry
ICC Immunocytochemistry
IP Immunoprecipitation
AT Array Tomography
EM Electron Microscopy
CHIP Chromatin Immunoprecipitation
DB Dot Blot

ICC WB

Immunogen:

Fusion protein amino acids 43-119 (MVVERDDGSTLMEIDGDKGKQGGPTYYIDTNALRVPRENME AISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHP, actin subdomain 2) of human BAF53a (also known as 53 kDa BRG1-associated factor A, BRG1-associated factor 53A, Actin-like protein 6A, ArpNbeta, ACTL6A, INO80 complex subunit K and INO80K, accession number O96019) Mouse: 96% identity (74/77 amino acids identical) Rat: 94% identity (73/77 amino acids identical) >50% identity with BAF53a

Cross Reactivity:

Does not cross-react with BAF53b

Protein Name(s):

Actin-like protein 6A (53 kDa BRG1-associated factor A) (Actin-related protein Baf53a) (ArpNbeta) (BRG1-associated factor 53A) (BAF53A) (INO80 complex subunit K)

Gene Name(s):

ACTL6A BAF53 BAF53A INO80K

Antibody Registry ID:

Purified: AB_2315809
TC Supernatant: AB_2315808


Antibody Validation and Application Notes


This antibody has been validated using the following assays:
Western Blot:

This antibody recognizes a single immunoreactive band of expected molecular weight when used to probe lysate from COS cells overexpressing target.

Immunocytochemistry:

This antibody shows the expected staining pattern when used to stain COS cells overexpressing target.

Expected Banding Pattern:

53 kDa


Quality Control


The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.

Each new lot of this antibody is tested to confirm that it shows the expected staining pattern when used to stain COS cells overexpressing target.