Anti-SUR1 Antibody (N289/16)

Name: Anti-SUR1 Antibody
Brand: NeuroMab
SKU: 75-267
Price: 329.0 USD
Availability: InStock

Our Anti-SUR1 mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N289/16. It is KO validated, detects hamster, mouse, rat SUR1, and is purified by Protein A chromatography. It is great for use in IHC, ICC, WB.

Immunofluorescence against SUR1 WT (left) and null mutant (right) mouse striatum and stained with N289/16 (green) and commercial antibody against Tyrosine Hydroxylase (blue). Images courtesy of Paul Witkovsky, Jyoti Patel and Margaret Rice, New York University Medical Center.

Adult rat hippocampus immunohistochemistry (with antigen retrieval via Na citrate pretreatment).

Immunoblot versus crude brain membrane preparations from rat (RBM), SUR1 wild-type (WT) and knockout (KO) mice and probed with N289/16 (left), N52A/42 (center) and K89/34 (right) TC supe. Mouse brains courtesy of William Coetzee and Margaret Rice, New York University Medical Center.

Immunofluorescence against SUR1 WT (left) and null mutant (right) mouse striatum and stained with N289/16 (green) and commercial antibody against Tyrosine Hydroxylase (blue). Images courtesy of Paul Witkovsky, Jyoti Patel and Margaret Rice, New York University Medical Center.

Roll over image to zoom in Click on image to zoom

Species Reactivity

Hamster, Mouse, Rat

Applications

ICC, IHC, WB

Host Species

Mouse

Conjugates and Formulations

490

550

594

650

Carrier-Free

Go to Full Product Details

Data Sheet

KO Validated

SKU: 75-267

Volume: 100 µL

Variant

Price:

$329.00

Quantity:

Ships: 1-2 business days

Product Details

Target

SUR1

Target Description

Sulfonylurea receptor 1 (SUR1), or ATP binding cassette transporter subfamily C member 8 is encoded by the gene ABCC8 and is a member of the ABC transporter super family. SUR1 acts to modulate ATP sensitive potassium channels and combines with Kir6.2 (KCNJ11). SUR1 is involved in insulin release. SUR1 has broad expression in many tissues including brain, heart, pancreas (beta cells). Diseases associated with this gene include Familial Hyperinsulinemic Hypoglycemia and Diabetes Mellitus.

Format

Purified by Protein A chromatography

Concentration

1 mg/mL

Clonality

Monoclonal

Clone

N289/16

Isotype

IgG1

Applications

ICC, IHC, WB

Host Species

Mouse

Gene Name

Abcc8 Sur Sur1

Molecular Weight

180 kDa

Antigen

Fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat SUR1 (accession number Q09429) produced recombinantly in E. Coli

Species Reactivity

Hamster, Mouse, Rat

Antibody Registry ID

AB_11001558

Storage

Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.

Physical State

Liquid

Production Notes

Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography. Purified mAbs are >90% specific antibody.

Buffer

10 mM Tris, 50 mM Sodium Chloride, 0.065% Sodium Azide pH 7.125

Conjugate

Unconjugated

Specificity

Does not cross-react with SUR2B (based on KO validation results)

Quality Control

Each new lot of antibody is quality control tested by western blot on rat whole brain lysate and confirmed to stain the expected molecular weight band.

Usage Statement

These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.

Country of Origin

United States

Expiration

24 months from date of receipt

Shipping

Shipped on ice packs

Synonyms

ATP-binding cassette sub-family C member 8 (Sulfonylurea receptor 1)

UniProt ID

Q09429

Product Specific References for Applications and Species

Immunocytochemistry: Human
Immunohistochemistry: Mouse
Western Blot: Hamster | Human | Mouse | Rat

Immunocytochemistry: Human
PMID	Dilution	Publication
24392021	1:500	Karnik, R., et al. 2013. Endocytosis of HERG is clathrin-independent and involves arf6.. PLoS One, e85630.

Immunohistochemistry: Mouse
PMID	Dilution	Publication
29960115	1:200	Ruan, J.S., et al. 2018. Chronic palmitic acid-induced lipotoxicity correlates with defective trafficking of ATP sensitive potassium channels in pancreatic β cells. Journal of Nutritional Biochemistry, 37-48.
23858470	1:200	Park, S.H., et al. 2013. Leptin promotes K(ATP) channel trafficking by AMPK signaling in pancreatic β-cells.. PNAS USA, 12673-12678.

Western Blot: Hamster
PMID	Dilution	Publication
23798684	not listed	Li, J.B., et al. 2013. Decomposition of slide helix contributions to ATP-dependent inhibition of Kir6.2 channels.. Journal of Biological Chemistry, 23038-23049.

Western Blot: Human
PMID	Dilution	Publication
25720052	not listed	Harel, S., et al. 2015. Alternating hypoglycemia and hyperglycemia in a toddler with a homozygous p.R1419H ABCC8 mutation: an unusual clinical picture.. Journal of Pediatric Endocrinology and Metabolism, 345-351.
24257076	not listed	Bruin, J.E., et al. 2014. Characterization of polyhormonal insulin-producing cells derived in vitro from human embryonic stem cells.. Stem Cell Research, 194-208.

Western Blot: Mouse
PMID	Dilution	Publication
33529173	1:250	Zhang, H., et al. 2021. Complex consequences of Cantu syndrome SUR2 variant R1154Q in genetically modified mice. JCI Insight, e145934.
23858470	1:250	Park, S.H., et al. 2013. Leptin promotes K(ATP) channel trafficking by AMPK signaling in pancreatic β-cells.. PNAS USA, 12673-12678.

Western Blot: Rat
PMID	Dilution	Publication
29320741	1:500	Han, Y.E., et al. 2018. Endocytosis of KATP Channels Drives Glucose-Stimulated Excitation of Pancreatic β Cells. Cell Reports, 471-481.

Recover password

Create my account

Anti-SUR1 Antibody (N289/16)

SKU: 75-267

Product Details

Product Specific References for Applications and Species

Bulk Order Anti-SUR1 Antibody

Related Products

Recently Viewed