Products: Primary Antibodies

Anti-Ankyrin-G (Staining) Antibody (N106/65)

NeuroMab Logo from NeuroMab

 Datasheet

PRODUCT OPTIONS

Brand Catalog # Option Volume Concentration Price
Brand
NeuroMab Logo
Catalog #
75-147
Option
Purified
Volume
100 µL
Concentration
1 mg/mL
Price
$325.00
Brand
NeuroMab Logo
Catalog #
73-147
Option
TC Supernatant
Volume
5 mL
Concentration
Lot dependent
Price
$325.00

Validation Images


Product Details

Antibody Type:

Monoclonal

Host Species:

Mouse

Antibody Isotype:

IgG2b

Species Reactivity:

Human Mouse Rat

Applications:
WB Western Blot
IHC Immunohistochemistry
ICC Immunocytochemistry
IP Immunoprecipitation
AT Array Tomography
EM Electron Microscopy
CHIP Chromatin Immunoprecipitation
DB Dot Blot

ICC IHC

Target Description:

Ankyrin-G (ankyrin 3) is a member of the Ankyrin family which consists of Ankyrin R (1), Ankyrin B (2) and Ankyrin G (3) all of which are expressed in the nervous system. Ankyrins are structural proteins that aid in the attachment of integral membrane proteins with the spectrin-actin cytoskeleton, and thus targets voltage-gated sodium channels, potassium channels, cell adhesion molecules and others at the nodes of Ranvier and axonal initial segments (AIS). Variants in Ankyrin G have been linked to bipolar disorder.

Immunogen:

Fusion protein ~1000 amino acids of Ankyrin-G (also known as ANK-3 or ankyrin-3), sequence:EDAMTGDTDKYLGPQDLKELGDDSLPAEGYMGFSLGARSASLRSFSSDRS YTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAADTL DNVNLVSSPIHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRI TCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSM RGKERELIVLRSENGETWKEHQFDSKNEDLTELLNGMDEELDSPEELGKK RICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGA LTKRIRVGLQAQPVPDEIVKKILGNKATFSPIVTVEPRRRKFHKPITMTI PVPPPSGEGVSNGYKGDTTPNLRLLCSITGGTSPAQWEDITGTTPLTFIK DCVSFTTNVSARFWLADCHQVLETVGLATQLYRELICVPYMAKFVVFAKM NDPVESSLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCY GNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKT TKGLPQTAVCNLNITLPAHKKIEKTDRRQSFASLALRKRYSYLTEPGMSP QSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQ SFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGT RSFADENNVFHDPVDDGPPVVTAEDASLEDSKLEDSVPLTEMPEAVDVDE SQLENVCLSWQNETSSGNLESCAQARRVTGGLLDRLDDSPDQCRDSITSY LKGEAGKFEANGSHTEITPEAKTKSYFPESQNDVGKQSTKETLKPKIHGS GHVEEPASPLAAYQKSLEETSKLIIEETKPCVPVSMKKMSRTSPADGKPRL SLHEEEGSSGSEQKQGEGFKVKTKKEIRHVEKKAHHuman: 92% identity (920/994 amino acids identical, accession # E9PE32); Mouse: 89% identity (837/936 amino acids identical); Rat: 87% identity (820/935 amino acids identical)50% identity with Ankyrin-B

Cross Reactivity:

Does not cross-react with Ankyrin-B

Protein Name(s):

Ankyrin-G (Staining)

Gene Name(s):

ANK3

Antibody Registry ID:

Purified: AB_10675130
TC Supernatant: AB_10673449


Antibody Validation and Application Notes


This antibody has been validated using the following assays:
Immunocytochemistry:

This antibody shows the expected staining pattern when used to stain COS cells overexpressing target.

Immunohistochemistry:
This antibody shows the expected immunoperoxidase-diaminobenzidine / immunofluorescence staining pattern when used to stain brain sections.


Quality Control


The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.

Each new lot of this antibody is tested to confirm that it shows the expected immunoperoxidase-diaminobenzidine / immunofluorescence staining pattern when used to stain brain sections.