Products: Primary Antibodies
PRODUCT OPTIONS
Brand | Catalog # | Option | Volume | Concentration | Price | |
---|---|---|---|---|---|---|
Brand![]() |
Catalog # 75-353 |
Option Purified |
Volume 100 µL |
Concentration 1 mg/mL |
Price $285.00 |
|
Brand![]() |
Catalog # 73-353 |
Option TC Supernatant |
Volume 5 mL |
Concentration Lot dependent |
Price $285.00 |
Product Details
Monoclonal
Mouse
IgG1
Mouse Rat
ICC WB
Synaptic vesicle 2-related protein or SVOP is encoded by the gene SVOP. SVOP contains 12 transmembrane regions and has transporter and ion transmembrane transporter activity. SVOP is expressed early in development and expressed in brain and endocrine cells where it is found in synaptic vesicles and microvesicles. Diseases associated with SVOP include Intestinal Botulism and Familial Atrial Fibrillation.
Fusion protein amino acids 1-85 (MEEDLFQLRQLPVVKFRRTGESARSEDDAASGEHDVQIEGVRV GLEAVELDDGAAVPKEFANPTDDTFMVEDAVEAIGFGRFQWK, cytoplasmic N-terminus) of rat SVOP (also known as Synaptic vesicle 2-related protein and SV2-related protein, accession number Q9Z2I7) Mouse: 97% identity (83/85 amino acids identical) Human: 95% identity (81/85 amino acids identical) <20% overall identity with SVOPL/SVOP2 but >80% identity (14/16 amino acids) near C-terminus (TFMVEDAVEAIGFGRF)
Does not cross-react with SVOPL/SVOP2
Synaptic vesicle 2-related protein (SV2-related protein)
Svop
Purified: AB_2315934
TC Supernatant: AB_2315933
Antibody Validation and Application Notes
This antibody has been validated using the following assays:
This antibody has been knockout-validated in mouse brain (by Western blot and/or immunohistochemistry).
This antibody recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.
This antibody shows the expected staining pattern when used to stain COS cells overexpressing target.
60 kDa
Quality Control
The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.
Each new lot of this antibody is tested to confirm that it recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.