Need help? Contact us at (800) 824-8540

Products: Primary Antibodies

Anti-SVOP (N356/23)


 Download Full Datasheet

PRODUCT OPTIONS

Catalog # Option Volume Concentration Price*
Catalog #
75-353
Option
Purified
Volume
100 µL
Concentration
1 mg/mL
Price
$269.00
Catalog #
73-353
Option
TC Supernatant
Volume
5 mL
Concentration
Lot dependent
Price
$269.00

Validation Images


Overview

Brand:

NeuroMab

Antibody Type:

Monoclonal

Host Species:

Mouse

Antibody Isotype:

IgG1

Species Reactivity:

Mouse Rat

Applications:
WB Western Blot
IHC Immunohistochemistry
ICC Immunocytochemistry
IP Immunoprecipitation
AT Array Tomography
EM Electron Microscopy
CHIP Chromatin Immunoprecipitation
DB Dot Blot

ICC WB

Immunogen:

Fusion protein amino acids 1-85 (MEEDLFQLRQLPVVKFRRTGESARSEDDAASGEHDVQIEGVRV GLEAVELDDGAAVPKEFANPTDDTFMVEDAVEAIGFGRFQWK, cytoplasmic N-terminus) of rat SVOP (also known as Synaptic vesicle 2-related protein and SV2-related protein, accession number Q9Z2I7) Mouse: 97% identity (83/85 amino acids identical) Human: 95% identity (81/85 amino acids identical) <20% overall identity with SVOPL/SVOP2 but >80% identity (14/16 amino acids) near C-terminus (TFMVEDAVEAIGFGRF)

Cross Reactivity:

Does not cross-react with SVOPL/SVOP2

Protein Name(s):

Synaptic vesicle 2-related protein (SV2-related protein)

Gene Name(s):

Svop

Antibody Registry ID:

Purified: AB_2315934
TC Supernatant: AB_2315933


Antibody Validation and Application Notes


This antibody has been validated using the following assays:
Knockout Validation:

This antibody has been knockout-validated in mouse brain (by Western blot and/or immunohistochemistry).

Western Blot:

This antibody recognizes a single immunoreactive band of expected molecularweight when used to probe brain lysate.

Immunocytochemistry:

This antibody shows the expected staining pattern when used to stain COS cells overexpressing target.

Molecular Weight:

60 kDa


Quality Control


The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.

Each new lot of this antibody is tested to confirm that it recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.