When placing orders, please note whether your facility is currently receiving packages

Products: Primary Antibodies

Anti-SVOP Antibody (N356/23)

NeuroMab Logo from NeuroMab

 Datasheet

PRODUCT OPTIONS

Brand Catalog # Option Volume Concentration Price
Brand
NeuroMab Logo
Catalog #
75-353
Option
Purified
Volume
100 µL
Concentration
1 mg/mL
Price
$275.00
Brand
NeuroMab Logo
Catalog #
73-353
Option
TC Supernatant
Volume
5 mL
Concentration
Lot dependent
Price
$275.00

Validation Images


Product Details

Antibody Type:

Monoclonal

Host Species:

Mouse

Antibody Isotype:

IgG1

Species Reactivity:

Mouse Rat

Applications:
WB Western Blot
IHC Immunohistochemistry
ICC Immunocytochemistry
IP Immunoprecipitation
AT Array Tomography
EM Electron Microscopy
CHIP Chromatin Immunoprecipitation
DB Dot Blot

ICC WB

Target Description:

Synaptic vesicle 2-related protein or SVOP is encoded by the gene SVOP. SVOP contains 12 transmembrane regions and has transporter and ion transmembrane transporter activity. SVOP is expressed early in development and expressed in brain and endocrine cells where it is found in synaptic vesicles and microvesicles. Diseases associated with SVOP include Intestinal Botulism and Familial Atrial Fibrillation.

Immunogen:

Fusion protein amino acids 1-85 (MEEDLFQLRQLPVVKFRRTGESARSEDDAASGEHDVQIEGVRV GLEAVELDDGAAVPKEFANPTDDTFMVEDAVEAIGFGRFQWK, cytoplasmic N-terminus) of rat SVOP (also known as Synaptic vesicle 2-related protein and SV2-related protein, accession number Q9Z2I7) Mouse: 97% identity (83/85 amino acids identical) Human: 95% identity (81/85 amino acids identical) <20% overall identity with SVOPL/SVOP2 but >80% identity (14/16 amino acids) near C-terminus (TFMVEDAVEAIGFGRF)

Cross Reactivity:

Does not cross-react with SVOPL/SVOP2

Protein Name(s):

Synaptic vesicle 2-related protein (SV2-related protein)

Gene Name(s):

Svop

Antibody Registry ID:

Purified: AB_2315934
TC Supernatant: AB_2315933


Antibody Validation and Application Notes


This antibody has been validated using the following assays:
Knockout Validation:

This antibody has been knockout-validated in mouse brain (by Western blot and/or immunohistochemistry).

Western Blot:

This antibody recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.

Immunocytochemistry:

This antibody shows the expected staining pattern when used to stain COS cells overexpressing target.

Molecular Weight:

60 kDa


Quality Control


The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.

Each new lot of this antibody is tested to confirm that it recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.