Products: Primary Antibodies

Anti-SVOP Antibody (N356/23)

from NeuroMab

PRODUCT OPTIONS

Brand	Catalog #	Option	Volume	Concentration	Price
Brand	Catalog # 75-353	Option Purified	Volume 100 µL	Concentration 1 mg/mL	Price $285.00
Brand	Catalog # 73-353	Option TC Supernatant	Volume 5 mL	Concentration Lot dependent	Price $285.00

"TC Supernatant" vs. "Purified"

TC Supernatant
Hybridoma tissue-culture supernatant (5mL) generally containing 10-50 ug/mL monoclonal antibody (clone-dependent) can be a very economical choice. Supernatant is suitable for most applications including Western Blot, immunocytochemistry, immunohistochemistry etc. For applications requiring higher antibody concentration or purity (such as immunoprecipitation, microinjection, or conjugation) it is recommended that you purchase the purified form of the antibody (supplied at 1mg/mL).

Purified mAbs
Produced by in vitro bioreactor culture of hybridoma lines followed by Protein A affinity chromatography. Purified mAbs are >90% specific antibody at 1mg/mL.

Validation Images

Product Details

Antibody Type:

Monoclonal

Host Species:

Mouse

Antibody Isotype:

IgG1

Species Reactivity:

Mouse Rat

Applications:

ICC WB

Target Description:

Synaptic vesicle 2-related protein or SVOP is encoded by the gene SVOP. SVOP contains 12 transmembrane regions and has transporter and ion transmembrane transporter activity. SVOP is expressed early in development and expressed in brain and endocrine cells where it is found in synaptic vesicles and microvesicles. Diseases associated with SVOP include Intestinal Botulism and Familial Atrial Fibrillation.

Immunogen:

Fusion protein amino acids 1-85 (MEEDLFQLRQLPVVKFRRTGESARSEDDAASGEHDVQIEGVRV GLEAVELDDGAAVPKEFANPTDDTFMVEDAVEAIGFGRFQWK, cytoplasmic N-terminus) of rat SVOP (also known as Synaptic vesicle 2-related protein and SV2-related protein, accession number Q9Z2I7) Mouse: 97% identity (83/85 amino acids identical) Human: 95% identity (81/85 amino acids identical) <20% overall identity with SVOPL/SVOP2 but >80% identity (14/16 amino acids) near C-terminus (TFMVEDAVEAIGFGRF)

Cross Reactivity:

Does not cross-react with SVOPL/SVOP2

Protein Name(s):

Synaptic vesicle 2-related protein (SV2-related protein)

Gene Name(s):

Svop

Antibody Registry ID:

Purified: AB_2315934
TC Supernatant: AB_2315933

Antibody Validation and Application Notes

This antibody has been validated using the following assays:

Knockout Validation:

This antibody has been knockout-validated in mouse brain (by Western blot and/or immunohistochemistry).

Western Blot:

This antibody recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.

Immunocytochemistry:

This antibody shows the expected staining pattern when used to stain COS cells overexpressing target.

Molecular Weight:

60 kDa

Quality Control

The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.

Each new lot of this antibody is tested to confirm that it recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.