Products: Primary Antibodies

Anti-SUR1 and SUR2B (N323A/31)


 Download Full Datasheet

PRODUCT OPTIONS

Catalog # Option Volume Concentration Price*
Catalog #
75-298
Option
Purified
Volume
100 µL
Concentration
1 mg/mL
Price
$205.00
Catalog #
73-298
Option
TC Supernatant
Volume
5 mL
Concentration
Lot dependent
Price
$180.00

Overview

Brand:

NeuroMab

Antibody Type:

Monoclonal

Host Species:

Mouse

Antibody Isotype:

IgG1

Species Reactivity:

Mouse Rat

Applications:
WB Western Blot
IHC Immunohistochemistry
ICC Immunocytochemistry
IP Immunoprecipitation
AT Array Tomography
EM Electron Microscopy
CHIP Chromatin Immunoprecipitation
DB Dot Blot

ICC WB

Immunogen:

Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B (also known as Sulfonylurea receptor 2B, ATP-binding cassette transporter subfamily C member 9B and Abcc9B, accession number Q63563-2)
Mouse: 100% identity (43/43 amino acids identical)
Human: 97% identity (42/43 amino acids identical)
75% identity with SUR1

Cross Reactivity:

Cross-reacts with SUR1

Protein Name(s):

ATP-binding cassette sub-family C member 8 (Sulfonylurea receptor 1) ATP-binding cassette sub-family C member 9 (Sulfonylurea receptor 2)

Gene Name(s):

Abcc8 Sur Sur1 Abcc9 Sur2

Antibody Registry ID:

Purified: AB_2315926
TC Supernatant: AB_2315925


Antibody Validation and Application Notes


This antibody has been validated using the following assays:
Western Blot:

This antibody recognizes a single immunoreactive band of expected molecularweight when used to probe brain lysate.

Immunocytochemistry:

This antibody shows the expected staining pattern when used to stain COS cells overexpressing target.

Immunohistochemistry:
This antibody shows the expected immunoperoxidase-diaminobenzidine/immunofluorescence staining pattern when used to stain brain sections.

Expected Banding Pattern:

175 kDa (and smaller fragments likely due to proteolytic cleavage)


Quality Control


The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.

Each new lot of this antibody is tested to confirm that it shows the expected staining pattern when used to stain COS cells overexpressing target.