Products: Primary Antibodies

Anti-SUR1 and SUR2B (N323A/31)

Download Full Datasheet

PRODUCT OPTIONS

Catalog #	Option	Volume	Concentration	Price*
Catalog # 75-298	Option Purified	Volume 100 µL	Concentration 1 mg/mL	Price $269.00
Catalog # 73-298	Option TC Supernatant	Volume 5 mL	Concentration Lot dependent	Price $269.00

"TC Supernatant" vs. "Purified"

TC Supernatant
Hybridoma tissue-culture supernatant (5mL) generally containing 10-50 ug/mL monoclonal antibody (clone-dependent) can be a very economical choice. Supernatant is suitable for most applications including Western Blot, immunocytochemistry, immunohistochemistry etc. For applications requiring higher antibody concentration or purity (such as immunoprecipitation, microinjection, or conjugation) it is recommended that you purchase the purified form of the antibody (supplied at 1mg/mL).

Purified mAbs
Produced by in vitro bioreactor culture of hybridoma lines followed by Protein A affinity chromatography. Purified mAbs are >90% specific antibody at 1mg/mL.

Validation Images

Overview

Brand:

NeuroMab

Antibody Type:

Monoclonal

Host Species:

Mouse

Antibody Isotype:

IgG1

Species Reactivity:

Mouse Rat

Applications:

ICC WB

Immunogen:

Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B (also known as Sulfonylurea receptor 2B, ATP-binding cassette transporter subfamily C member 9B and Abcc9B, accession number Q63563-2)
Mouse: 100% identity (43/43 amino acids identical)
Human: 97% identity (42/43 amino acids identical)
75% identity with SUR1

Cross Reactivity:

Cross-reacts with SUR1

Protein Name(s):

ATP-binding cassette sub-family C member 8 (Sulfonylurea receptor 1) ATP-binding cassette sub-family C member 9 (Sulfonylurea receptor 2)

Gene Name(s):

Abcc8 Sur Sur1 Abcc9 Sur2

Antibody Registry ID:

Purified: AB_2315926
TC Supernatant: AB_2315925

Antibody Validation and Application Notes

This antibody has been validated using the following assays:

Western Blot:

This antibody recognizes a single immunoreactive band of expected molecularweight when used to probe brain lysate.

Immunocytochemistry:

This antibody shows the expected staining pattern when used to stain COS cells overexpressing target.

Immunohistochemistry:

This antibody shows the expected immunoperoxidase-diaminobenzidine/immunofluorescence staining pattern when used to stain brain sections.

Expected Banding Pattern:

175 kDa (and smaller fragments likely due to proteolytic cleavage)

Quality Control

The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.

Each new lot of this antibody is tested to confirm that it shows the expected staining pattern when used to stain COS cells overexpressing target.