Products: Primary Antibodies
PRODUCT OPTIONS
Brand | Catalog # | Option | Volume | Concentration | Price | |
---|---|---|---|---|---|---|
Brand![]() |
Catalog # 75-298 |
Option Purified |
Volume 100 µL |
Concentration 1 mg/mL |
Price $285.00 |
|
Brand![]() |
Catalog # 73-298 |
Option TC Supernatant |
Volume 5 mL |
Concentration Lot dependent |
Price $285.00 |
Product Details
Monoclonal
Mouse
IgG1
Mouse Rat
ICC WB
SUR1 and SUR2B are members of the ATP binding cassette transporter subfamily C. These proteins combine with KCNJ8(Kir6.1) or KCNJ11(Kir6.2) to form K+ATP channels and are involved in their regulation and activation.
Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B (also known as Sulfonylurea receptor 2B, ATP-binding cassette transporter subfamily C member 9B and Abcc9B, accession number Q63563-2)
Mouse: 100% identity (43/43 amino acids identical)
Human: 97% identity (42/43 amino acids identical)
75% identity with SUR1
Cross-reacts with SUR1
ATP-binding cassette sub-family C member 8 (Sulfonylurea receptor 1) ATP-binding cassette sub-family C member 9 (Sulfonylurea receptor 2)
Abcc8 Sur Sur1 Abcc9 Sur2
Purified: AB_2315926
TC Supernatant: AB_2315925
Antibody Validation and Application Notes
This antibody has been validated using the following assays:
This antibody recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.
This antibody shows the expected staining pattern when used to stain COS cells overexpressing target.
175 kDa (and smaller fragments likely due to proteolytic cleavage)
Quality Control
The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.
Each new lot of this antibody is tested to confirm that it shows the expected staining pattern when used to stain COS cells overexpressing target.