Products: Primary Antibodies
PRODUCT OPTIONS
Catalog # | Option | Volume | Concentration | Price* | |
---|---|---|---|---|---|
Catalog # 75-368 |
Option Purified |
Volume 100 µL |
Concentration 1 mg/mL |
Price $269.00 |
|
Catalog # 73-368 |
Option TC Supernatant |
Volume 5 mL |
Concentration Lot dependent |
Price $269.00 |
Overview
NeuroMab
Monoclonal
Mouse
IgG1
Mouse Rat
ICC IHC WB
Fusion protein amino acids 111-254 (cytoplasmic C-terminus) of mouse REEP2 (also known as Receptor expression-enhancing protein 2, C5orf19, SGC32445 and LOC682105, accession number Q8VCD6) Rat: 97% identity (140/144 amino acids identical) Human: 86% identity (125/144 amino acids identical) <40% identity with REEP1 and REEP4 but >65% identity for first 46 amino acids (RDKSYETMMRV GKRGLNLAANAAVTAAAKGQGVLSEKLRSFSMQDL)
Cross-reacts with REEP1
Receptor expression-enhancing protein 1 (Spastic paraplegia 31 protein) Receptor expression-enhancing protein 2
Reep1 D6Ertd253e C2orf23 SPG31 Reep2 C5orf19 SGC32445
Purified: AB_2315911
TC Supernatant: AB_2315910
Antibody Validation and Application Notes
This antibody has been validated using the following assays:
This antibody recognizes a single immunoreactive band of expected molecularweight when used to probe brain lysate.
This antibody shows the expected staining pattern when used to stain COS cells overexpressing target.
30 kDa
Quality Control
The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.
Each new lot of this antibody is tested to confirm that it recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.