Products: Primary Antibodies

Anti-REEP (N326D/13)


 Download Full Datasheet

PRODUCT OPTIONS

Catalog # Option Volume Concentration Price*
Catalog #
75-368
Option
Purified
Volume
100 µL
Concentration
1 mg/mL
Price
$205.00
Catalog #
73-368
Option
TC Supernatant
Volume
5 mL
Concentration
Lot dependent
Price
$180.00

Overview

Brand:

NeuroMab

Antibody Type:

Monoclonal

Host Species:

Mouse

Antibody Isotype:

IgG1

Species Reactivity:

Mouse Rat

Applications:
WB Western Blot
IHC Immunohistochemistry
ICC Immunocytochemistry
IP Immunoprecipitation
AT Array Tomography
EM Electron Microscopy
CHIP Chromatin Immunoprecipitation
DB Dot Blot

ICC IHC WB

Immunogen:

Fusion protein amino acids 111-254 (cytoplasmic C-terminus) of mouse REEP2 (also known as Receptor expression-enhancing protein 2, C5orf19, SGC32445 and LOC682105, accession number Q8VCD6) Rat: 97% identity (140/144 amino acids identical) Human: 86% identity (125/144 amino acids identical) <40% identity with REEP1 and REEP4 but >65% identity for first 46 amino acids (RDKSYETMMRV GKRGLNLAANAAVTAAAKGQGVLSEKLRSFSMQDL)

Cross Reactivity:

Cross-reacts with REEP1

Protein Name(s):

Receptor expression-enhancing protein 1 (Spastic paraplegia 31 protein) Receptor expression-enhancing protein 2

Gene Name(s):

Reep1 D6Ertd253e C2orf23 SPG31 Reep2 C5orf19 SGC32445

Antibody Registry ID:

Purified: AB_2315911
TC Supernatant: AB_2315910


Antibody Validation and Application Notes


This antibody has been validated using the following assays:
Western Blot:

This antibody recognizes a single immunoreactive band of expected molecularweight when used to probe brain lysate.

Immunocytochemistry:

This antibody shows the expected staining pattern when used to stain COS cells overexpressing target.

Immunohistochemistry:
This antibody shows the expected immunoperoxidase-diaminobenzidine/immunofluorescence staining pattern when used to stain brain sections.

Expected Banding Pattern:

30 kDa


Quality Control


The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.

Each new lot of this antibody is tested to confirm that it recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.