Products: Primary Antibodies

Anti-REEP (N326D/13)

NeuroMab Logo from NeuroMab



Brand Catalog # Option Volume Concentration Price
NeuroMab Logo
Catalog #
100 µL
1 mg/mL
NeuroMab Logo
Catalog #
TC Supernatant
5 mL
Lot dependent

Validation Images




Antibody Type:


Host Species:


Antibody Isotype:


Species Reactivity:

Mouse Rat

WB Western Blot
IHC Immunohistochemistry
ICC Immunocytochemistry
IP Immunoprecipitation
AT Array Tomography
EM Electron Microscopy
CHIP Chromatin Immunoprecipitation
DB Dot Blot



Fusion protein amino acids 111-254 (cytoplasmic C-terminus) of mouse REEP2 (also known as Receptor expression-enhancing protein 2, C5orf19, SGC32445 and LOC682105, accession number Q8VCD6) Rat: 97% identity (140/144 amino acids identical) Human: 86% identity (125/144 amino acids identical) <40% identity with REEP1 and REEP4 but >65% identity for first 46 amino acids (RDKSYETMMRV GKRGLNLAANAAVTAAAKGQGVLSEKLRSFSMQDL)

Cross Reactivity:

Cross-reacts with REEP1

Protein Name(s):

Receptor expression-enhancing protein 1 (Spastic paraplegia 31 protein) Receptor expression-enhancing protein 2

Gene Name(s):

Reep1 D6Ertd253e C2orf23 SPG31 Reep2 C5orf19 SGC32445

Antibody Registry ID:

Purified: AB_2315911
TC Supernatant: AB_2315910

Antibody Validation and Application Notes

This antibody has been validated using the following assays:
Western Blot:

This antibody recognizes a single immunoreactive band of expected molecularweight when used to probe brain lysate.


This antibody shows the expected staining pattern when used to stain COS cells overexpressing target.

This antibody shows the expected immunoperoxidase-diaminobenzidine/immunofluorescence staining pattern when used to stain brain sections.

Molecular Weight:

30 kDa

Quality Control

The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.

Each new lot of this antibody is tested to confirm that it recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.