Need help? Contact us at (800) 824-8540.

Products: Primary Antibodies

Anti-Kv1.2 potassium channel subunit (L76/36)


 Download Full Datasheet

PRODUCT OPTIONS

Catalog # Option Volume Concentration Price*
Catalog #
75-314
Option
Purified
Volume
100 µL
Concentration
1 mg/mL
Price
$269.00
Catalog #
73-314
Option
TC Supernatant
Volume
5 mL
Concentration
Lot dependent
Price
$269.00

Validation Images


Overview

Brand:

NeuroMab

Antibody Type:

Monoclonal

Host Species:

Mouse

Antibody Isotype:

IgG2a

Species Reactivity:

Human Mouse Rat

Applications:
WB Western Blot
IHC Immunohistochemistry
ICC Immunocytochemistry
IP Immunoprecipitation
AT Array Tomography
EM Electron Microscopy
CHIP Chromatin Immunoprecipitation
DB Dot Blot

IHC WB

Immunogen:

Fusion protein amino acids 428-499 (QYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSN EDFREENLKTANCTLANTNYVNITKMLTDV, cytoplasmic C-terminus) of human Kv1.2 (also known as Potassium voltage-gated channel subfamily A member 2, Voltage-gated K(+) channel HuKIV or HBK5, Kcna2, NGK1, RAK, RBK2, RCK5 and MK2, accession number P16389), epitope mapped to within underlined sequence (amino acids 463-480) Mouse: 100% identity (72/72 amino acids identical) Rat: 100% identity (72/72 amino acids identical) Some identity with Kv1.1, Kv1.3 and Kv1.4

Protein Name(s):

Potassium voltage-gated channel subfamily A member 2 (NGK1) (Voltage-gated K(+) channel HuKIV) (Voltage-gated potassium channel HBK5) (Voltage-gated potassium channel subunit Kv1.2)

Gene Name(s):

KCNA2

Antibody Registry ID:

Purified: AB_2315859
TC Supernatant: AB_2315858


Antibody Validation and Application Notes


This antibody has been validated using the following assays:
Knockout Validation:

This antibody has been knockout-validated in mouse brain (by Western blot and/or immunohistochemistry).

Western Blot:

This antibody recognizes a single immunoreactive band of expected molecularweight when used to probe brain lysate.

Immunocytochemistry:

This antibody shows the expected staining pattern when used to stain COS cells overexpressing target.

Immunohistochemistry:
This antibody shows the expected immunoperoxidase-diaminobenzidine/immunofluorescence staining pattern when used to stain brain sections.

Expected Banding Pattern:

80 kDa


Quality Control


The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.

Each new lot of this antibody is tested to confirm that it recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.


Citations and References