Anti-Kv1.2 Potassium Channel Subunit Antibody FL550 Conjugate (L76/36)
Our Anti-Kv1.2 potassium channel subunit mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone L76/36. It is KO validated, detects human, mouse, and rat Kv1.2 potassium channel subunit, and is purified by Protein A chromatography. It is great for use in IHC.
Human, Mouse, Rat
ICC, IHC
Mouse
KO Validated
SKU: 75-314-FL550
Product Details
Kv1.2 potassium channel subunit
Potassium voltage-gated channel subfamily A member 2 (also known as Potassium Voltage-Gated Channel A Member 2 , Shaker-Related Subfamily, Member 2 or Voltage-Gated Potassium Channel Protein Kv1.2, or KCNA2) is a member of the Kv family of potassium channels. Kv1.2 contains six membrane spanning domains and belongs to the delayer rectifier class of potassium channels. Kv2.1 mediates the voltage dependent potassium ion permeability of excitable membranes. Kv1.2 binds PDZ domains of DLG1, DLG2 and DLG4. Kv1.2 is found primarily in the brain (at the axon initial segment, axon preterminals and juxtaparanode domains), central nervous system, but also in the cardiovascular system. Kv2.1 has been implicated in epileptic encephalopathy, early infantile, and episodic ataxia, type 1.
Purified by Protein A chromatography
0.5 mg/mL
Monoclonal
L76/36
IgG2a
ICC, IHC
Mouse
KCNA2
80 kDa
Fusion protein amino acids 428-499 (QYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSN EDFREENLKTANCTLANTNYVNITKMLTDV, cytoplasmic C-terminus) of human Kv1.2 (accession number P16389) produced recombinantly in E. Coli
Human, Mouse, Rat
AB_2940097
Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
Liquid
Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography and conjugation of purified mAb. Purified mAbs are >90% specific antibody.
PBS with 0.09% azide
FL550 Ex: 550 nm, Em: 575 nm
No cross-reactivity reported
Each new lot of antibody is quality control tested by western blot on rat whole brain lysate and confirmed to stain the expected molecular weight band.
These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.
United States
12 months from date of receipt
Shipped on ice packs
Potassium voltage-gated channel subfamily A member 2 (NGK1) (Voltage-gated K(+) channel HuKIV) (Voltage-gated potassium channel HBK5) (Voltage-gated potassium channel subunit Kv1.2)
UniProt (Human): P16389
UniProt (Immunogen Species): P16389
UniProt (Immunogen Species): P16389