NOTICE: Deliveries are being delayed all across the US. Expect longer than normal shipping times.

Products: Primary Antibodies

Anti-Kir6.2 potassium channel Antibody (N363/71)

NeuroMab Logo from NeuroMab



Brand Catalog # Option Volume Concentration Price
NeuroMab Logo
Catalog #
100 µL
1 mg/mL
NeuroMab Logo
Catalog #
TC Supernatant
5 mL
Lot dependent

Validation Images

Product Details

Antibody Type:


Host Species:


Antibody Isotype:


Species Reactivity:

Mouse Rat

WB Western Blot
IHC Immunohistochemistry
ICC Immunocytochemistry
IP Immunoprecipitation
AT Array Tomography
EM Electron Microscopy
CHIP Chromatin Immunoprecipitation
DB Dot Blot


Target Description:

ATP-sensitive inward rectifier potassium channel 11 or Kir6.2 is encoded by the gene KCNJ11. Kir6.2 is an integral membrane protein which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins. Kir6.2 has broad expression in many tissues including brain, heart, pancreas (beta cells) and thyroid. Diseases associated with this gene include several forms of diabetes.


Fusion protein amino acids 345-390 (TARQLDEDRSLLDALTLASSRGPLRKRSVAVAKAKPKFSISPDSLS, cytoplasmic C-terminus) of rat Kir6.2 (also known as ATP-sensitive inward rectifier potassium channel 11, Potassium channel inwardly rectifying subfamily J member 11, IKATP, Kcnj11 and BIR, accession number P70673)
Mouse: 100% identity (46/46 amino acids identical)
Human: 89% identity (41/46 amino acids identical)
50% identity with Kir6.1

Cross Reactivity:

Does not cross-react with Kir6.1

Protein Name(s):

ATP-sensitive inward rectifier potassium channel 11 (BIR) (Inward rectifier K(+) channel Kir6.2) (Potassium channel, inwardly rectifying subfamily J member 11)

Gene Name(s):


Antibody Registry ID:

Purified: AB_2491088
TC Supernatant: AB_2336908

Antibody Validation and Application Notes

This antibody has been validated using the following assays:
Western Blot:

This antibody recognizes a single immunoreactive band of expected molecular weight when used to probe lysate from COS cells overexpressing target.

This antibody recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.


This antibody shows the expected staining pattern when used to stain COS cells overexpressing target.

Molecular Weight:

45 kDa

Quality Control

The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.

Each new lot of this antibody is tested to confirm that it shows the expected staining pattern when used to stain COS cells overexpressing target.