Need help? Contact us at (800) 824-8540.

Products: Primary Antibodies

Anti-GluA2/GluR2 glutamate receptor (L21/32)


 Download Full Datasheet

PRODUCT OPTIONS

Catalog # Option Volume Concentration Price*
Catalog #
75-002
Option
Purified
Volume
100 µL
Concentration
1 mg/mL
Price
$319.00
Catalog #
75-002-020
Option
Purified Trial-Size
Volume
20 µL
Concentration
1 mg/mL
Price
$99.00
Catalog #
73-002
Option
TC Supernatant
Volume
5 mL
Concentration
Lot dependent
Price
$319.00

Validation Images


Overview

Brand:

NeuroMab

Antibody Type:

Monoclonal

Host Species:

Mouse

Antibody Isotype:

IgG1

Species Reactivity:

Human Mouse Rat

Applications:
WB Western Blot
IHC Immunohistochemistry
ICC Immunocytochemistry
IP Immunoprecipitation
AT Array Tomography
EM Electron Microscopy
CHIP Chromatin Immunoprecipitation
DB Dot Blot

EM IHC WB

Immunogen:

Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 (also known as Glutamate receptor 2, AMPA-selective glutamate receptor 2, Glutamate receptor ionotropic AMPA 2, GluR-B, GluR-K2 and Gria2, accession number P19491)
Mouse: 98% identity (49/50 amino acids identical)
Human: 98% identity (49/50 amino acids identical)
100% identity between Flip and Flop isoforms
70% identity with GluA3/GluR3 and less identity with GluA1/GluR1 and GluA4/GluR4

Cross Reactivity:

Does not cross-react with GluA1/GluR1, GluA3/GluR3 or GluA4/GluR4 (based on KO validation results)

Protein Name(s):

Glutamate receptor 2 (GluR-2) (AMPA-selective glutamate receptor 2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (GluA2)

Gene Name(s):

Gria2 Glur2

Antibody Registry ID:

Purified: AB_2232661
Purified Trial-Size: AB_2232661
TC Supernatant: AB_10674575


Antibody Validation and Application Notes


This antibody has been validated using the following assays:
Knockout Validation:

This antibody has been knockout-validated in mouse brain (by Western blot and/or immunohistochemistry).

Western Blot:

This antibody recognizes a single immunoreactive band of expected molecularweight when used to probe brain lysate.

Immunocytochemistry:

This antibody shows the expected staining pattern when used to stain COS cells overexpressing target.

Immunohistochemistry:
This antibody shows the expected immunoperoxidase-diaminobenzidine/immunofluorescence staining pattern when used to stain brain sections.

Expected Banding Pattern:

90 kDa


Quality Control


The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.

Each new lot of this antibody is tested to confirm that it recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.


Citations and References