Need help? Contact us at (800) 824-8540.

Products: Primary Antibodies

Anti-GluA2/GluR2 glutamate receptor (L21/32)

 Download Full Datasheet


Catalog # Option Volume Concentration Price*
Catalog #
100 µL
1 mg/mL
Catalog #
Purified Trial-Size
20 µL
1 mg/mL
Catalog #
TC Supernatant
5 mL
Lot dependent

Validation Images




Antibody Type:


Host Species:


Antibody Isotype:


Species Reactivity:

Human Mouse Rat

WB Western Blot
IHC Immunohistochemistry
ICC Immunocytochemistry
IP Immunoprecipitation
AT Array Tomography
EM Electron Microscopy
CHIP Chromatin Immunoprecipitation
DB Dot Blot



Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 (also known as Glutamate receptor 2, AMPA-selective glutamate receptor 2, Glutamate receptor ionotropic AMPA 2, GluR-B, GluR-K2 and Gria2, accession number P19491)
Mouse: 98% identity (49/50 amino acids identical)
Human: 98% identity (49/50 amino acids identical)
100% identity between Flip and Flop isoforms
70% identity with GluA3/GluR3 and less identity with GluA1/GluR1 and GluA4/GluR4

Cross Reactivity:

Does not cross-react with GluA1/GluR1, GluA3/GluR3 or GluA4/GluR4 (based on KO validation results)

Protein Name(s):

Glutamate receptor 2 (GluR-2) (AMPA-selective glutamate receptor 2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (GluA2)

Gene Name(s):

Gria2 Glur2

Antibody Registry ID:

Purified: AB_2232661
Purified Trial-Size: AB_2232661
TC Supernatant: AB_10674575

Antibody Validation and Application Notes

This antibody has been validated using the following assays:
Knockout Validation:

This antibody has been knockout-validated in mouse brain (by Western blot and/or immunohistochemistry).

Western Blot:

This antibody recognizes a single immunoreactive band of expected molecularweight when used to probe brain lysate.


This antibody shows the expected staining pattern when used to stain COS cells overexpressing target.

This antibody shows the expected immunoperoxidase-diaminobenzidine/immunofluorescence staining pattern when used to stain brain sections.

Molecular Weight:

90 kDa

Quality Control

The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.

Each new lot of this antibody is tested to confirm that it recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.

Citations and References