There will be a delay in shipping of orders for the week of Sept. 21 to 25 as we are taking inventory.

Products: Primary Antibodies

Anti-Ataxin-1, 11NQ Antibody (N76/3)

NeuroMab Logo from NeuroMab

 Datasheet

PRODUCT OPTIONS

Brand Catalog # Option Volume Concentration Price
Brand
NeuroMab Logo
Catalog #
75-122
Option
Purified
Volume
100 µL
Concentration
1 mg/mL
Price
$275.00
Brand
NeuroMab Logo
Catalog #
73-122
Option
TC Supernatant
Volume
5 mL
Concentration
Lot dependent
Price
$275.00

Validation Images


Product Details

Antibody Type:

Monoclonal

Host Species:

Mouse

Antibody Isotype:

IgG1

Species Reactivity:

Human Mouse Rat

Applications:
WB Western Blot
IHC Immunohistochemistry
ICC Immunocytochemistry
IP Immunoprecipitation
AT Array Tomography
EM Electron Microscopy
CHIP Chromatin Immunoprecipitation
DB Dot Blot

IHC IP WB

Target Description:

Ataxin1, also known as spinocerebellar ataxia type 1 protein homolog, is a highly conserved DNA-binding protein. Ataxin1 is expressed in brain and can be found at high levels in the cortex and the hypothalamus in neurons. It is also expressed in other tissues. Within the cell, it is highly expressed in the nucleus, and can also be found in the cytoplasm. Mutations in the ataxin-1 gene cause spinocerebellar ataxia type 1.

Immunogen:

Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse ataxin-1 (also known as spinocerebellar ataxia type 1 protein homolog, accession number P54254); Rat: 100% identity (34/34 amino acids identical); Human: 88% identity (30/34 amino acids identical)

Cross Reactivity:

No cross-reactivity reported

Protein Name(s):

Ataxin-1, 11NQ

Gene Name(s):

Atxn1 Sca1

Antibody Registry ID:

Purified: AB_2061163
TC Supernatant: AB_10671696


Antibody Validation and Application Notes


This antibody has been validated using the following assays:
Knockout Validation:

This antibody has been knockout-validated in mouse brain (by Western blot and/or immunohistochemistry).

Western Blot:

This antibody recognizes a single immunoreactive band of expected molecular weight when used to probe lysate from COS cells overexpressing target.

This antibody recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.

Immunocytochemistry:

This antibody shows the expected staining pattern when used to stain COS cells overexpressing target.

Immunohistochemistry:
This antibody shows the expected immunoperoxidase-diaminobenzidine / immunofluorescence staining pattern when used to stain brain sections.

Molecular Weight:

85 kDa


Quality Control


The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.

Each new lot of this antibody is tested to confirm that it shows the expected staining pattern when used to stain COS cells overexpressing target.