When placing orders, please note whether your facility is currently receiving packages

Products: Primary Antibodies

Anti-Ataxin-1, 11NQ Antibody (N76/3)

NeuroMab Logo from NeuroMab



Brand Catalog # Option Volume Concentration Price
NeuroMab Logo
Catalog #
100 µL
1 mg/mL
NeuroMab Logo
Catalog #
TC Supernatant
5 mL
Lot dependent

Validation Images

Product Details

Antibody Type:


Host Species:


Antibody Isotype:


Species Reactivity:

Human Mouse Rat

WB Western Blot
IHC Immunohistochemistry
ICC Immunocytochemistry
IP Immunoprecipitation
AT Array Tomography
EM Electron Microscopy
CHIP Chromatin Immunoprecipitation
DB Dot Blot


Target Description:

Ataxin1, also known as spinocerebellar ataxia type 1 protein homolog, is a highly conserved DNA-binding protein. Ataxin1 is expressed in brain and can be found at high levels in the cortex and the hypothalamus in neurons. It is also expressed in other tissues. Within the cell, it is highly expressed in the nucleus, and can also be found in the cytoplasm. Mutations in the ataxin-1 gene cause spinocerebellar ataxia type 1.


Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse ataxin-1 (also known as spinocerebellar ataxia type 1 protein homolog, accession number P54254); Rat: 100% identity (34/34 amino acids identical); Human: 88% identity (30/34 amino acids identical)

Cross Reactivity:

No cross-reactivity reported

Protein Name(s):

Ataxin-1, 11NQ

Gene Name(s):

Atxn1 Sca1

Antibody Registry ID:

Purified: AB_2061163
TC Supernatant: AB_10671696

Antibody Validation and Application Notes

This antibody has been validated using the following assays:
Knockout Validation:

This antibody has been knockout-validated in mouse brain (by Western blot and/or immunohistochemistry).

Western Blot:

This antibody recognizes a single immunoreactive band of expected molecular weight when used to probe lysate from COS cells overexpressing target.

This antibody recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.


This antibody shows the expected staining pattern when used to stain COS cells overexpressing target.

This antibody shows the expected immunoperoxidase-diaminobenzidine / immunofluorescence staining pattern when used to stain brain sections.

Molecular Weight:

85 kDa

Quality Control

The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.

Each new lot of this antibody is tested to confirm that it shows the expected staining pattern when used to stain COS cells overexpressing target.