Anti-MFF Antibody FL490 Conjugate (N382/14)
Our Anti-MFF mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N382/14. It is KO validated, detects human, mouse, and rat MFF, and is purified by Protein A chromatography. It is great for use in IHC, ICC.
Human, Mouse, Rat
ICC, IHC
Mouse

SKU: 75-366-FL490
Ships: 1-5 business days
Product Details
MFF
Mitochondrial fission factor, also known as Mff, is a tail-anchored, outer mitochondrial membrane protein that is part of a complex process controlling mitochondrial and peroxisomal fission in conjunction with Drp1 and Fis1 (Schrader and Yoon, 2007). The rate of mitochondrial fission and fusion balance each other for cell growth and survival of mitochondria. Fission can be greatly accelerated when cytochrome c is released during apoptosis (Desagher and Martinou, 2000). Mff was identified as an important component of the process through siRNA transfected cells, isolating the protein in the P2 pellet and demonstrating that Mff is exposed to the cytosol (Gandre-Babbe and van der Bliek 2008). Mff has been identified at different stages of the fission process working alongside, rather than in complex with, Fis1 suggesting that Mff contributes to fission independent of the Fis1 complex (Gandre-Babbe and van der Bliek 2008).
Purified by Protein A chromatography
0.5 mg/mL
Monoclonal
N382/14
IgG1
ICC, IHC
Mouse
MFF C2orf33 AD030 AD033 GL004
40 kDa
Fusion protein amino acids 1-173 (MSKRTSSDTPLGRVSGAAFPSPTASEMAEISRIQYEMEYTEGIS QRMRVPEKLKVAPPNADLEQGFQEGVPNASVIMQVPERIVVAGNNEDVSFSRPADLDLIQS TPFKPLALKTPPRVLTLSERPLDFLDLERPPVTPQNEEIRAVGRLKRERSMSENAVRQNGQL VRNDSV, cytoplasmic N-terminal exons 1, 2, 3 and 4) and 272-322 (YGISNIEATIEGTSDDM TVVDAASLRRQIIKLNRRLQLLEEENKERAKREM, cytoplasmic N-terminal exons 8 and most of 9) of mostly human MFF (also known as Mitochondrial fission factor, C2orf33, AD030, AD033 and GL004, accession number Q9GZY8); Human: 96% identity (167/173 amino acids identical) and 94% identity (48/51 amino acids identical); Rat: 95% identity (141/147 amino acids identical) and 92% identity (47/51 amino acids identical); Mouse: 93% identity (138/147 amino acids identical) and 84% identity (43/51 amino acids identical)
Human
Human, Mouse, Rat
AB_2940228
Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
Liquid
Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography and conjugation of purified mAb. Purified mAbs are >90% specific antibody.
PBS with 0.09% azide
FL490 Ex: 491 nm, Em: 515 nm
No cross-reactivity reported
Each new lot of antibody is quality control tested by western blot on rat whole brain lysate and confirmed to stain the expected molecular weight band.
These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.
United States
12 months from date of receipt
Mitochondrial fission factor
Shipped on ice packs