Products: Primary Antibodies

Anti-Ankyrin-G (Blotting) (N106/20)


 Download Full Datasheet

PRODUCT OPTIONS

Catalog # Option Concentration Price*
Catalog #
75-187
Option
Purified
Concentration
1 mg/mL
Price
$205.00
Catalog #
73-187
Option
TC Supernatant
Concentration
Lot dependent
Price
$180.00

Overview

Brand:

NeuroMab

Antibody Type:

Monoclonal

Host Species:

Mouse

Antibody Isotype:

IgG1

Species Reactivity:

Human Mouse Rat

Applications:
WB Western Blot
IHC Immunohistochemistry
ICC Immunocytochemistry
IP Immunoprecipitation
AT Array Tomography
EM Electron Microscopy
CHIP Chromatin Immunoprecipitation
DB Dot Blot

ICC WB

Immunogen:

Fusion protein ~1000 amino acids of Ankyrin-G (also known as ANK-3 or ankyrin-3), sequence: EDAMTGDTDKYLGPQDLKELGDDSLPAEGYMGFSLGARSASLRSFSSDRS YTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAADTL DNVNLVSSPIHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRI TCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSM RGKERELIVLRSENGETWKEHQFDSKNEDLTELLNGMDEELDSPEELGKK RICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGA LTKRIRVGLQAQPVPDEIVKKILGNKATFSPIVTVEPRRRKFHKPITMTI PVPPPSGEGVSNGYKGDTTPNLRLLCSITGGTSPAQWEDITGTTPLTFIK DCVSFTTNVSARFWLADCHQVLETVGLATQLYRELICVPYMAKFVVFAKM NDPVESSLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCY GNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKT TKGLPQTAVCNLNITLPAHKKIEKTDRRQSFASLALRKRYSYLTEPGMSP QSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQ SFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGT RSFADENNVFHDPVDDGPPVVTAEDASLEDSKLEDSVPLTEMPEAVDVDE SQLENVCLSWQNETSSGNLESCAQARRVTGGLLDRLDDSPDQCRDSITSY LKGEAGKFEANGSHTEITPEAKTKSYFPESQNDVGKQSTKETLKPKIHGS GHVEEPASPLAAYQKSLEETSKLIIEETKPCVPVSMKKMSRTSPADGKPR LSLHEEEGSSGSEQKQGEGFKVKTKKEIRHVEKKAH Human: 92% identity (920/994 amino acids identical, accession # E9PE32) Mouse: 89% identity (837/936 amino acids identical) Rat: 87% identity (820/935 amino acids identical) <50% identity with Ankyrin-B

Protein Name(s):

Ankyrin-3 (ANK-3) (Ankyrin-G)

Gene Name(s):

ANK3

Antibody Registry ID:

Purified: AB_2057718
TC Supernatant: AB_10674433


Antibody Validation and Application Notes


This antibody has been validated using the following assays:
Western Blot:

This antibody recognizes a single immunoreactive band of expected molecularweight when used to probe brain lysate.

Immunocytochemistry:

This antibody shows the expected staining pattern when used to stain COS cells overexpressing target.

Expected Banding Pattern:

>200 kDa


Quality Control


The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.

Each new lot of this antibody is tested to confirm that it recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.