Anti-GluA2/GluR2 Glutamate Receptor Recombinant Chicken Chimeric mAb Biotin Conjugate (L21/32)
Our chicken GluA2/GluR2 glutamate receptor biotin conjugate recombinant antibody from Aves Labs is produced in-house from clone L21/32. It detects human, mouse, and rat GluA2/GluR2 glutamate receptor and is purified by affinity chromatography. KO validated. Works in ELISA, IHC, ICC, WB, IP.
Anti-GluA2/GluR2 Glutamate Receptor Recombinant Chicken Chimeric mAb Biotin Conjugate
Glutelin type-A 2 (GluA2) , also called GRIA2, GLUR2, GLURB, GluA2, GluR-K2, HBGR2 or glutamate ionotropic receptor AMPA type subunit 2, is a member of the Glutamate receptor family of the mammalian brain. This neurotransmiter receptor subunit, which is activated during normal central nervous system fuction, is encoded by the GRIA2 (or GLUR2) gene. GluA2 constitutes a key subunit that regulates AMPA receptors. AMPA receptors lacking of Glua2 have been shown to be present in diseased brains, whose basic fuctions have been altered.
Purified by affinity chromatography
Lot dependent: provided at 0.3-0.5 mg/mL
Recombinant
L21/32
IgY
ELISA, ICC, IHC, IP, WB
Chicken
Gria2 Glur2
90 kDa
Fusion Protein Amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 produced recombinantly in E. Coli
Rat
Human, Mouse, Rat
Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
Liquid
This recombinant antibody is a chimeric antibody created by replacing the mouse heavy and light constant regions of clone L21/32 with chicken IgY heavy and light constant regions. As such this antibody retains the same binding performance as the original clone L21/32 but can be detected using standard anti-chicken secondary antibodies allowing flexibility for multiplexing applications. This antibody is expressed recombinantly in mammalian cells and then affinity purified from the cell culture media and conjugated.
1X PBS, 0.05% Sodium Azide pH 7.4
IHC: 1:250-1:500
ICC: 1:500
Biotin
Does not cross-react with GluA1/GluR1, GluA3/GluR3 or GluA4/GluR4 (based on KO validation results)
These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.
Trial Size