Products: Primary Antibodies

Anti-SUR1 Antibody (N289/16)

from NeuroMab

PRODUCT OPTIONS

Brand	Catalog #	Option	Volume	Concentration	Price
Brand	Catalog # 75-267	Option Purified	Volume 100 µL	Concentration 1 mg/mL	Price $275.00
Brand	Catalog # 73-267	Option TC Supernatant	Volume 5 mL	Concentration Lot dependent	Price $275.00

"TC Supernatant" vs. "Purified"

TC Supernatant
Hybridoma tissue-culture supernatant (5mL) generally containing 10-50 ug/mL monoclonal antibody (clone-dependent) can be a very economical choice. Supernatant is suitable for most applications including Western Blot, immunocytochemistry, immunohistochemistry etc. For applications requiring higher antibody concentration or purity (such as immunoprecipitation, microinjection, or conjugation) it is recommended that you purchase the purified form of the antibody (supplied at 1mg/mL).

Purified mAbs
Produced by in vitro bioreactor culture of hybridoma lines followed by Protein A affinity chromatography. Purified mAbs are >90% specific antibody at 1mg/mL.

Validation Images

Product Details

Antibody Type:

Monoclonal

Host Species:

Mouse

Antibody Isotype:

IgG1

Species Reactivity:

Hamster Mouse Rat

Applications:

ICC IHC WB

Target Description:

Sulfonylurea receptor 1 (SUR1), or ATP binding cassette transporter subfamily C member 8 is encoded by the gene ABCC8 and is a member of the ABC transporter super family. SUR1 acts to modulate ATP sensitive potassium channels and combines with Kir6.2 (KCNJ11). SUR1 is involved in insulin release. SUR1 has broad expression in many tissues including brain, heart, pancreas (beta cells). Diseases associated with this gene include Familial Hyperinsulinemic Hypoglycemia and Diabetes Mellitus.

Immunogen:

Fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat SUR1 (also known as Sulfonylurea receptor 1, SUR, HRINS, ATP binding cassette transporter subfamily C member 8 and Abcc8, accession number Q09429)
Mouse: 100% identity (35/35 amino acids identical)
Human: 94% identity (33/35 amino acids identical) Similar % identity with other isoforms >70% identity with SUR2B

Cross Reactivity:

Does not cross-react with SUR2B (based on KO validation results)

Protein Name(s):

ATP-binding cassette sub-family C member 8 (Sulfonylurea receptor 1)

Gene Name(s):

Abcc8 Sur Sur1

Antibody Registry ID:

Purified: AB_11001558
TC Supernatant: AB_11001671

Antibody Validation and Application Notes

This antibody has been validated using the following assays:

Knockout Validation:

This antibody has been knockout-validated in mouse brain (by Western blot and/or immunohistochemistry).

Western Blot:

This antibody recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.

Immunocytochemistry:

This antibody shows the expected staining pattern when used to stain COS cells overexpressing target.

Immunohistochemistry:

This antibody shows the expected immunoperoxidase-diaminobenzidine / immunofluorescence staining pattern when used to stain brain sections.

Molecular Weight:

180 kDa

Quality Control

The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.

Each new lot of this antibody is tested to confirm that it recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.

Citations and References

Harel S, Cohen AS, Hussain K, Flanagan SE, Schlade-Bartusiak K, Patel M, Courtade J, Li JB, Van Karnebeek C, Kurata H, Ellard S, Chanoine JP, Gibson WT.. (2015), 'Alternating hypoglycemia and hyperglycemia in a toddler with a homozygous p.R1419H ABCC8 mutation: an unusual clinical picture..' J Pediatr Endocrinol Metab.. 10.1515/jpem-2014-0265.
Karnik R1, Ludlow MJ2, Abuarab N1, Smith AJ1, Hardy ME1, Elliott DJ1, Sivaprasadarao A2.. (2013), 'Endocytosis of HERG is clathrin-independent and involves arf6..' PLoS One.. 10.1371/journal.pone.0085630.
Bruin JE1, Erener S1, Vela J1, Hu X1, Johnson JD2, Kurata HT3, Lynn FC2, Piret JM4, Asadi A1, Rezania A5, Kieffer TJ6.. (2014), 'Characterization of polyhormonal insulin-producing cells derived in vitro from human embryonic stem cells..' Stem Cell Res. . 10.1016/j.scr.2013.10.003.
Park SH1, Ryu SY, Yu WJ, Han YE, Ji YS, Oh K, Sohn JW, Lim A, Jeon JP, Lee H, Lee KH, Lee SH, Berggren PO, Jeon JH, Ho WK.. (2013), 'Leptin promotes K(ATP) channel trafficking by AMPK signaling in pancreatic β-cells..' Proc Natl Acad Sci U S A. . 10.1073/pnas.1216351110.
Li JB1, Huang X, Zhang RS, Kim RY, Yang R, Kurata HT.. (2013), 'Decomposition of slide helix contributions to ATP-dependent inhibition of Kir6.2 channels..' J Biol Chem. . 10.1074/jbc.M113.485789.