Need help? Contact us at (800) 824-8540.

Products: Primary Antibodies

Anti-SUR1 (N289/16)

 Download Full Datasheet


Catalog # Option Volume Concentration Price*
Catalog #
100 µL
1 mg/mL
Catalog #
TC Supernatant
5 mL
Lot dependent

Validation Images




Antibody Type:


Host Species:


Antibody Isotype:


Species Reactivity:

Hamster Mouse Rat

WB Western Blot
IHC Immunohistochemistry
ICC Immunocytochemistry
IP Immunoprecipitation
AT Array Tomography
EM Electron Microscopy
CHIP Chromatin Immunoprecipitation
DB Dot Blot



Fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat SUR1 (also known as Sulfonylurea receptor 1, SUR, HRINS, ATP binding cassette transporter subfamily C member 8 and Abcc8, accession number Q09429)
Mouse: 100% identity (35/35 amino acids identical)
Human: 94% identity (33/35 amino acids identical) Similar % identity with other isoforms >70% identity with SUR2B

Cross Reactivity:

Does not cross-react with SUR2B (based on KO validation results)

Protein Name(s):

ATP-binding cassette sub-family C member 8 (Sulfonylurea receptor 1)

Gene Name(s):

Abcc8 Sur Sur1

Antibody Registry ID:

Purified: AB_11001558
TC Supernatant: AB_11001671

Antibody Validation and Application Notes

This antibody has been validated using the following assays:
Knockout Validation:

This antibody has been knockout-validated in mouse brain (by Western blot and/or immunohistochemistry).

Western Blot:

This antibody recognizes a single immunoreactive band of expected molecularweight when used to probe brain lysate.


This antibody shows the expected staining pattern when used to stain COS cells overexpressing target.

This antibody shows the expected immunoperoxidase-diaminobenzidine/immunofluorescence staining pattern when used to stain brain sections.

Expected Banding Pattern:

180 kDa

Quality Control

The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.

Each new lot of this antibody is tested to confirm that it recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.

Citations and References