When placing orders, please note whether your facility is currently receiving packages

Products: Primary Antibodies

Anti-SUR1 Antibody (N289/16)

NeuroMab Logo from NeuroMab



Brand Catalog # Option Volume Concentration Price
NeuroMab Logo
Catalog #
100 µL
1 mg/mL
NeuroMab Logo
Catalog #
TC Supernatant
5 mL
Lot dependent

Validation Images

Product Details

Antibody Type:


Host Species:


Antibody Isotype:


Species Reactivity:

Hamster Mouse Rat

WB Western Blot
IHC Immunohistochemistry
ICC Immunocytochemistry
IP Immunoprecipitation
AT Array Tomography
EM Electron Microscopy
CHIP Chromatin Immunoprecipitation
DB Dot Blot


Target Description:

Sulfonylurea receptor 1 (SUR1), or ATP binding cassette transporter subfamily C member 8 is encoded by the gene ABCC8 and is a member of the ABC transporter super family. SUR1 acts to modulate ATP sensitive potassium channels and combines with Kir6.2 (KCNJ11). SUR1 is involved in insulin release. SUR1 has broad expression in many tissues including brain, heart, pancreas (beta cells). Diseases associated with this gene include Familial Hyperinsulinemic Hypoglycemia and Diabetes Mellitus.


Fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat SUR1 (also known as Sulfonylurea receptor 1, SUR, HRINS, ATP binding cassette transporter subfamily C member 8 and Abcc8, accession number Q09429)
Mouse: 100% identity (35/35 amino acids identical)
Human: 94% identity (33/35 amino acids identical) Similar % identity with other isoforms >70% identity with SUR2B

Cross Reactivity:

Does not cross-react with SUR2B (based on KO validation results)

Protein Name(s):

ATP-binding cassette sub-family C member 8 (Sulfonylurea receptor 1)

Gene Name(s):

Abcc8 Sur Sur1

Antibody Registry ID:

Purified: AB_11001558
TC Supernatant: AB_11001671

Antibody Validation and Application Notes

This antibody has been validated using the following assays:
Knockout Validation:

This antibody has been knockout-validated in mouse brain (by Western blot and/or immunohistochemistry).

Western Blot:

This antibody recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.


This antibody shows the expected staining pattern when used to stain COS cells overexpressing target.

This antibody shows the expected immunoperoxidase-diaminobenzidine / immunofluorescence staining pattern when used to stain brain sections.

Molecular Weight:

180 kDa

Quality Control

The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.

Each new lot of this antibody is tested to confirm that it recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.

Citations and References