Immunoblot against adult rat brain membranes (RBM) and membranes from SVOP knockout (KO) and wild-type (WT) mice probed with N356/23 (left) and N52A/42 (right) TC supe. Mouse brains courtesy of Jia Yao and Sandra Bajjalieh (University of Washington.
Anti-SVOP Antibody
SKU: 75-353
Bulk Order Anti-SVOP Antibody
Product Details
Synaptic vesicle 2-related protein (SV2-related protein)
Synaptic vesicle 2-related protein or SVOP is encoded by the gene SVOP. SVOP contains 12 transmembrane regions and has transporter and ion transmembrane transporter activity. SVOP is expressed early in development and expressed in brain and endocrine cells where it is found in synaptic vesicles and microvesicles. Diseases associated with SVOP include Intestinal Botulism and Familial Atrial Fibrillation.
Purified
1 mg/mL
Monoclonal
N356/23
IgG1
ICC, WB
Mouse
Svop
60 kDa
Fusion protein amino acids 1-85 (MEEDLFQLRQLPVVKFRRTGESARSEDDAASGEHDVQIEGVRVGLEAVELDDGAAVPKEFANPTDDTFMVEDAVEAIGFGRFQWK, cytoplasmic N-terminus) of rat SVOP (also known as Synaptic vesicle 2-related protein and SV2-related protein, accession number Q9Z2I7); Mouse: 97% identity (83/85 amino acids identical); Human: 95% identity (81/85 amino acids identical); Less than 20% overall identity with SVOPL/SVOP2 but Greater than 80% identity (14/16 amino acids) near C-terminus (TFMVEDAVEAIGFGRF)
Mouse, Rat
AB_2315934
Store at ≤ -20 C for long term storage. For short term storage, store at 2-8 C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
Each new lot of this antibody is tested to confirm that it recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.
These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.
United States
24 months from opening
Synaptic vesicle 2-related protein (SV2-related protein)