Potassium voltage-gated channel subfamily A member 2 (also known as Potassium Voltage-Gated Channel A Member 2 , Shaker-Related Subfamily, Member 2 or Voltage-Gated Potassium Channel Protein Kv1.2, or KCNA2) is a member of the Kv family of potassium channels. Kv1.2 contains six membrane spanning domains and belongs to the delayer rectifier class of potassium channels. Kv2.1 mediates the voltage dependent potassium ion permeability of excitable membranes. Kv1.2 binds PDZ domains of DLG1, DLG2 and DLG4. Kv1.2 is found primarily in the brain (at the axon initial segment, axon preterminals and juxtaparanode domains), central nervous system, but also in the cardiovascular system. Kv2.1 has been implicated in epileptic encephalopathy, early infantile, and episodic ataxia, type 1.
Purified
1 mg/mL
Monoclonal
L76/36
IgG2a
IHC, WB
Mouse
KCNA2
80 kDa
Fusion protein amino acids 428-499 (QYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSN EDFREENLKTANCTLANTNYVNITKMLTDV, cytoplasmic C-terminus) of human Kv1.2 (also known as Potassium voltage-gated channel subfamily A member 2, Voltage-gated K(+) channel HuKIV or HBK5, Kcna2, NGK1, RAK, RBK2, RCK5 and MK2, accession number P16389), epitope mapped to within underlined sequence (amino acids 463-480)
Mouse: 100% identity (72/72 amino acids identical)
Rat: 100% identity (72/72 amino acids identical)
Some identity with Kv1.1, Kv1.3 and Kv1.4
Human, Mouse, Rat
AB_2315859
Store at ≤ -20 C for long term storage. For short term storage, store at 2-8 C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
Each new lot of this antibody is tested to confirm that it recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.
These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.