Anti-Agouti related protein (AGRP) Antibody
Our Anti-Agouti related protein (AGRP) guinea pig polyclonal primary antibody detects human, mouse, rat, and sheep Agouti related protein (AGRP), and is whole serum. It is validated for use in IHC-Frozen.
The 4% PFA fixed, frozen cryostat section of the sheep hypothalamus was incubated in guinea pig polyclonal antibodies to the mouse AGRP protein at the dilution of 1:1000 overnight followed by incubation with biotinylated secondary antibodies. Cell bodies and nerve terminals in the sheep brain are intensely stained. This figure shows staining of cells when no pre-absorption is performed.
Click on image to zoom
SKU: GP-029-50
Ships: 5-7 business days
Product Details
Agouti related protein (AGRP)
AGRP is the endogenous antagonist of alpha-melanocyte stimulating hormone and has been shown to cause potent stimulation of food intake, and this protein is found in over 90% of Neuropeptide Y containing cells in rats.
Whole serum
Polyclonal
Mixed
IHC
Guinea Pig
A synthetic peptide (SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT) corresponding to a region (82-131) within the carboxy domain of mouse agouti related protein. This peptide was conjugated to carrier protein to enhance the immunological response.
Mouse
Human, Mouse, Rat, Sheep
Spin vial briefly before opening. Reconstitute in 50 µL sterile-filtered, ultrapure water. Centrifuge to remove any insoluble material. Store lyophilized antibody at 2-8°C or lower. After reconstitution, divide into aliquots and store at -20°C, or lower, for optimal long term stability. It is recommended that a reconstituted aliquot is stored at 2-8°C for no longer than 2 weeks. Allocation of an appropriate anti-bacterial agent can increase shelf life by several weeks. Glycerol (1:1) can be added to neat serum for additional stability if intended use does not prevent this.
Lyophilized
Neat serum
IHC: 1:1000-1:2000
IHC, frozen, PFA fixed material. Not yet tested on paraffin embedded tissue sections. A concentration of 1:1000 to 1:2000 is recommended for IHC with overnight incubations. Permeabilization suggested is 0.1% triton X-100 in blocking buffer. IHC performed in sheep brain (hypothalamus) demonstrates intense staining of cells and terminals. No staining is evident when the primary antibody is pre-absorbed with 0.5 mg/mL of AGRP. In rodents such as rat cell terminal staining is most typically observed without cell body staining. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Unconjugated
Specificity was demonstrated by immunohistochemistry. This antibody is known to react with human, rat and sheep. Other species have not yet been tested.
For research use only.
United States
12 months after date of receipt (lyophilized, unopened vial).
Agrp; Agrt; Art; Agouti-related protein;
25°C (ambient)

