Products: Primary Antibodies
PRODUCT OPTIONS
Brand | Catalog # | Option | Volume | Concentration | Price | |
---|---|---|---|---|---|---|
Brand![]() |
Catalog # 75-358 |
Option Purified |
Volume 100 µL |
Concentration 1 mg/mL |
Price $285.00 |
|
Brand![]() |
Catalog # 73-358 |
Option TC Supernatant |
Volume 5 mL |
Concentration Lot dependent |
Price $285.00 |
Product Details
Monoclonal
Mouse
IgG1
Mouse Rat
ICC IHC WB
Voltage-gated K+ channels are important determinants of neuronal membrane excitability (Pongs, 1999). Moreover, differences in K+ channel expression patterns and densities contribute to the variations in action potential waveforms and repetitive firing patterns evident in different neuronal cell types. The delayed rectifier-type (IK)channels (Kv1.5, Kv2.1, and Kv2.2) are expressed on all neuronal somata and proximal dendrites and are also found in a wide variety of non-neuronal cells types including pancreatic islets, alveolar cells and cardiac myocytes (Hwang et al., 1993; Yan et al., 2004; Michaelevski et al., 2003). Kv2.1 and Kv2.2 form distinct populations of K+ channels and these subunits are thought to be primarily responsible for IK in superior cervical ganglion cells (Blaine and Ribera, 1998; Burger and Ribera, 1996).
Fusion protein amino acids 717-907 (cytoplasmic C-terminus) of rat Kv2.2 long isoform (also known as Potassium voltage-gated channel subfamily B member 2, Kcnb2 and CDRK, accession number NP_446452.2)
Mouse: 94% identity (180/191 amino acids identical)
Human: 84% identity (161/191 amino acids identical)
50% identity with Kv2.1 and other Kv2 channels
100% identity with Kv2.2 short isoform for first 47 amino acids (ENRGSAPQTPPSTARPLPVTTADFPLTTPQHMSTILLEEALPQGQRP)
Cross-reacts with Kv2.2 short isoform. Does not cross-react with Kv2.1
Potassium voltage-gated channel subfamily B member 2 (CDRK) (Voltage-gated potassium channel subunit Kv2.2)
Kcnb2
Purified: AB_2315866
TC Supernatant: AB_2315865
Antibody Validation and Application Notes
This antibody has been validated using the following assays:
This antibody has been knockout-validated in mouse brain (by Western blot and/or immunohistochemistry).
This antibody recognizes a single immunoreactive band of expected molecular weight when used to probe lysate from COS cells overexpressing target.
This antibody recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.
This antibody shows the expected staining pattern when used to stain COS cells overexpressing target.
120 kDa
Quality Control
The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.
Each new lot of this antibody is tested to confirm that it recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.
Citations and References
- Bishop HI1, Guan D2, Bocksteins E3, Parajuli LK4, Murray KD4, Cobb MM1, Misonou H5, Zito K6, Foehring RC2, Trimmer JS7.. (2015), 'Distinct Cell- and Layer-Specific Expression Patterns and Independent Regulation of Kv2 Channel Subtypes in Cortical Pyramidal Neurons..' J Neurosci. 10.1523/JNEUROSCI.1897-15.2015.