Products: Primary Antibodies

Anti-Kv2.2 potassium channel (N372C/51)

from NeuroMab

PRODUCT OPTIONS

Brand	Catalog #	Option	Volume	Concentration	Price
Brand	Catalog # 75-358	Option Purified	Volume 100 µL	Concentration 1 mg/mL	Price $275.00
Brand	Catalog # 73-358	Option TC Supernatant	Volume 5 mL	Concentration Lot dependent	Price $275.00

"TC Supernatant" vs. "Purified"

TC Supernatant
Hybridoma tissue-culture supernatant (5mL) generally containing 10-50 ug/mL monoclonal antibody (clone-dependent) can be a very economical choice. Supernatant is suitable for most applications including Western Blot, immunocytochemistry, immunohistochemistry etc. For applications requiring higher antibody concentration or purity (such as immunoprecipitation, microinjection, or conjugation) it is recommended that you purchase the purified form of the antibody (supplied at 1mg/mL).

Purified mAbs
Produced by in vitro bioreactor culture of hybridoma lines followed by Protein A affinity chromatography. Purified mAbs are >90% specific antibody at 1mg/mL.

Validation Images

Overview

Brand:

NeuroMab

Antibody Type:

Monoclonal

Host Species:

Mouse

Antibody Isotype:

IgG1

Species Reactivity:

Mouse Rat

Applications:

ICC IHC WB

Immunogen:

Fusion protein amino acids 717-907 (cytoplasmic C-terminus) of rat Kv2.2 long isoform (also known as Potassium voltage-gated channel subfamily B member 2, Kcnb2 and CDRK, accession number NP_446452.2)

Mouse: 94% identity (180/191 amino acids identical)
Human: 84% identity (161/191 amino acids identical)
50% identity with Kv2.1 and other Kv2 channels
100% identity with Kv2.2 short isoform for first 47 amino acids (ENRGSAPQTPPSTARPLPVTTADFPLTTPQHMSTILLEEALPQGQRP)

Cross Reactivity:

Cross-reacts with Kv2.2 short isoform. Does not cross-react with Kv2.1

Protein Name(s):

Potassium voltage-gated channel subfamily B member 2 (CDRK) (Voltage-gated potassium channel subunit Kv2.2)

Gene Name(s):

Kcnb2

Antibody Registry ID:

Purified: AB_2315866
TC Supernatant: AB_2315865

Antibody Validation and Application Notes

This antibody has been validated using the following assays:

Knockout Validation:

This antibody has been knockout-validated in mouse brain (by Western blot and/or immunohistochemistry).

Western Blot:

This antibody recognizes a single immunoreactive band of expected molecular weight when used to probe lysate from COS cells overexpressing target.

This antibody recognizes a single immunoreactive band of expected molecularweight when used to probe brain lysate.

Immunocytochemistry:

This antibody shows the expected staining pattern when used to stain COS cells overexpressing target.

Immunohistochemistry:

This antibody shows the expected immunoperoxidase-diaminobenzidine/immunofluorescence staining pattern when used to stain brain sections.

Molecular Weight:

120 kDa

Quality Control

The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.

Each new lot of this antibody is tested to confirm that it recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.

Citations and References

Bishop HI1, Guan D2, Bocksteins E3, Parajuli LK4, Murray KD4, Cobb MM1, Misonou H5, Zito K6, Foehring RC2, Trimmer JS7.. (2015), 'Distinct Cell- and Layer-Specific Expression Patterns and Independent Regulation of Kv2 Channel Subtypes in Cortical Pyramidal Neurons..' J Neurosci. 10.1523/JNEUROSCI.1897-15.2015.