When placing orders, please note whether your facility is currently receiving packages

Products: Primary Antibodies

Anti-Kv2.2 potassium channel Antibody (N372C/51)

NeuroMab Logo from NeuroMab

 Datasheet

PRODUCT OPTIONS

Brand Catalog # Option Volume Concentration Price
Brand
NeuroMab Logo
Catalog #
75-358
Option
Purified
Volume
100 µL
Concentration
1 mg/mL
Price
$275.00
Brand
NeuroMab Logo
Catalog #
73-358
Option
TC Supernatant
Volume
5 mL
Concentration
Lot dependent
Price
$275.00

Validation Images


Product Details

Antibody Type:

Monoclonal

Host Species:

Mouse

Antibody Isotype:

IgG1

Species Reactivity:

Mouse Rat

Applications:
WB Western Blot
IHC Immunohistochemistry
ICC Immunocytochemistry
IP Immunoprecipitation
AT Array Tomography
EM Electron Microscopy
CHIP Chromatin Immunoprecipitation
DB Dot Blot

ICC IHC WB

Target Description:

Voltage-gated K+ channels are important determinants of neuronal membrane excitability (Pongs, 1999). Moreover, differences in K+ channel expression patterns and densities contribute to the variations in action potential waveforms and repetitive firing patterns evident in different neuronal cell types. The delayed rectifier-type (IK)channels (Kv1.5, Kv2.1, and Kv2.2) are expressed on all neuronal somata and proximal dendrites and are also found in a wide variety of non-neuronal cells types including pancreatic islets, alveolar cells and cardiac myocytes (Hwang et al., 1993; Yan et al., 2004; Michaelevski et al., 2003). Kv2.1 and Kv2.2 form distinct populations of K+ channels and these subunits are thought to be primarily responsible for IK in superior cervical ganglion cells (Blaine and Ribera, 1998; Burger and Ribera, 1996).

Immunogen:

Fusion protein amino acids 717-907 (cytoplasmic C-terminus) of rat Kv2.2 long isoform (also known as Potassium voltage-gated channel subfamily B member 2, Kcnb2 and CDRK, accession number NP_446452.2) Mouse: 94% identity (180/191 amino acids identical)
Human: 84% identity (161/191 amino acids identical)
50% identity with Kv2.1 and other Kv2 channels
100% identity with Kv2.2 short isoform for first 47 amino acids (ENRGSAPQTPPSTARPLPVTTADFPLTTPQHMSTILLEEALPQGQRP)

Cross Reactivity:

Cross-reacts with Kv2.2 short isoform. Does not cross-react with Kv2.1

Protein Name(s):

Potassium voltage-gated channel subfamily B member 2 (CDRK) (Voltage-gated potassium channel subunit Kv2.2)

Gene Name(s):

Kcnb2

Antibody Registry ID:

Purified: AB_2315866
TC Supernatant: AB_2315865


Antibody Validation and Application Notes


This antibody has been validated using the following assays:
Knockout Validation:

This antibody has been knockout-validated in mouse brain (by Western blot and/or immunohistochemistry).

Western Blot:

This antibody recognizes a single immunoreactive band of expected molecular weight when used to probe lysate from COS cells overexpressing target.

This antibody recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.

Immunocytochemistry:

This antibody shows the expected staining pattern when used to stain COS cells overexpressing target.

Immunohistochemistry:
This antibody shows the expected immunoperoxidase-diaminobenzidine / immunofluorescence staining pattern when used to stain brain sections.

Molecular Weight:

120 kDa


Quality Control


The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.

Each new lot of this antibody is tested to confirm that it recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.


Citations and References