Need help? Contact us at (800) 824-8540.

Products: Primary Antibodies

Anti-Kv2.2 potassium channel (N372C/51)

 Download Full Datasheet


Catalog # Option Volume Concentration Price*
Catalog #
100 µL
1 mg/mL
Catalog #
TC Supernatant
5 mL
Lot dependent

Validation Images




Antibody Type:


Host Species:


Antibody Isotype:


Species Reactivity:

Mouse Rat

WB Western Blot
IHC Immunohistochemistry
ICC Immunocytochemistry
IP Immunoprecipitation
AT Array Tomography
EM Electron Microscopy
CHIP Chromatin Immunoprecipitation
DB Dot Blot



Fusion protein amino acids 717-907 (cytoplasmic C-terminus) of rat Kv2.2 long isoform (also known as Potassium voltage-gated channel subfamily B member 2, Kcnb2 and CDRK, accession number NP_446452.2)
Mouse: 94% identity (180/191 amino acids identical)
Human: 84% identity (161/191 amino acids identical)
50% identity with Kv2.1 and other Kv2 channels
100% identity with Kv2.2 short isoform for first 47 amino acids (ENRGSAPQTPPSTARPLPVTTADFPLTTPQHMSTILLEEALPQGQRP)

Cross Reactivity:

Cross-reacts with Kv2.2 short isoform. Does not cross-react with Kv2.1

Protein Name(s):

Potassium voltage-gated channel subfamily B member 2 (CDRK) (Voltage-gated potassium channel subunit Kv2.2)

Gene Name(s):


Antibody Registry ID:

Purified: AB_2315866
TC Supernatant: AB_2315865

Antibody Validation and Application Notes

This antibody has been validated using the following assays:
Knockout Validation:

This antibody has been knockout-validated in mouse brain (by Western blot and/or immunohistochemistry).

Western Blot:

This antibody recognizes a single immunoreactive band of expected molecular weight when used to probe lysate from COS cells overexpressing target.

This antibody recognizes a single immunoreactive band of expected molecularweight when used to probe brain lysate.


This antibody shows the expected staining pattern when used to stain COS cells overexpressing target.

This antibody shows the expected immunoperoxidase-diaminobenzidine/immunofluorescence staining pattern when used to stain brain sections.

Expected Banding Pattern:

120 kDa

Quality Control

The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.

Each new lot of this antibody is tested to confirm that it recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.

Citations and References