Anti-Presenilin 2 loop region Antibody
Our Anti-Presenilin 2 loop region rabbit polyclonal primary antibody detects human and mouse Presenilin 2 loop region, and is IgG. It is validated for use in ICC, WB.
SKU: R-1681-500
Product Details
Presenilin 2 loop region
Autosomal dominant mutations in presenilin 2 are the second major cause of early-onset familial Alzheimer's disease. Presenilin 2 is a multi-transmembrane protein which undergoes endoprotelysis to form an N-terminal fragment of about 29 kDa and C-terminal fragment of about 22 kDa. Presenilin 2 forms the catalytic core of the gamma-secretase complex which cleaves type 1 transmembrane proteins including the amyloid precursor protein to generate the C-terminus of the amyloid beta peptide.
IgG
Polyclonal
IgG
ICC, WB
Rabbit
22 kDa, 45 kDa (See application details.)
A synthetic peptide (KLDPSSQGALQLPYDPEMEEDSYDSFGEP-C) corresponding to human PS1 [306-334] in the loop region conjugated via additional C-terminal Cys to Diphtheria toxoid.
Human
Human, Mouse
Spin vial briefly before opening. Reconstitute in 500 µL sterile-filtered 1X PBS, pH 7.2-7.6. Centrifuge to remove any insoluble material. Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Lyophilized
Protein G purified IgG
Lyophilized from PBS, pH 7.4. Contains no preservative.
WB: 1:1000
IP: 1:100
IP: 1:100
Full length presenilin 2 (448 aa) has relative MW of about 45 kDa, with this antibody most commonly detected as cleaved CTF of 22 kDa with this antibody. Human or mouse brain samples commonly prepared with reducing agent (50 mM DTT), urea (2.3 M), SDS (1.5%) in 62.5 mM Tris-HCL pH 6.8 sample buffer (without boiling) heating to 50 C for 15 min.
Unconjugated
Confirmed by Western blot using mouse and human brain and knock down of presenilin 2 in vitro using siRNA see ref 6 below. Not reactive with presenilin 1.
For research use only.
United States
12 months after date of receipt (unopened vial).
AD3LP, AD5, E5-1, STM-2
25°C (ambient)