Anti-GluA2/GluR2 Glutamate Receptor Recombinant Chicken Chimeric mAb (L21/32)
Our chicken Anti-GluA2/GluR2 glutamate receptor recombinant monoclonal antibody is a chimeric antibody derived from NeuroMab clone L21/32. It detects human, mouse, and rat GluA2/GluR2 is purified by affinity chromatography. It works in WB, IHC, ICC, IP, ELISA, EM.
Representative section of formalin fixed, paraffin-embedded rat brain hippocampal region showing cells stained by anti-GluA2/GluR2 Glutamate Receptor recombinant chicken mAb (green, Cat No. 78-002) using goat anti-chicken IgY CF®488 secondary antibody (Cat No. 80-1001-488).
Click on image to zoom
Human, Mouse, Rat
ELISA, EM, ICC, IHC, IP, WB
Chicken
SKU: 78-002
Ships: 1-2 business days
Product Details
GluA2/GluR2 glutamate receptor
Glutelin type-A 2 (GluA2) , also called GRIA2, GLUR2, GLURB, GluA2, GluR-K2, HBGR2 or glutamate ionotropic receptor AMPA type subunit 2, is a member of the Glutamate receptor family of the mammalian brain. This neurotransmiter receptor subunit, which is activated during normal central nervous system fuction, is encoded by the GRIA2 (or GLUR2) gene. GluA2 constitutes a key subunit that regulates AMPA receptors. AMPA receptors lacking of Glua2 have been shown to be present in diseased brains, whose basic fuctions have been altered.
Purified by affinity chromatography
1 mg/mL
Recombinant
L21/32
IgY
ELISA, EM, ICC, IHC, IP, WB
Chicken
Gria2 Glur2
90 kDa
Unconjugated
Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 produced recombinantly in E. Coli
Rat
Human, Mouse, Rat
Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
Liquid
This recombinant antibody is a chimeric antibody created by replacing the mouse heavy and light constant regions of clone L21/32 with chicken IgY heavy and light constant regions. As such this antibody retains the same binding performance as the original clone L21/32 but can be detected using standard anti-chicken secondary antibodies allowing flexibility for multiplexing applications. This antibody is expressed recombinantly in mammalian cells and then affinity purified from the cell culture media.
1X PBS, 0.05% Sodium Azide pH 7.4
WB: 1:500-1:1000
WB Brain: 1:500-1:1000
IHC: 1:250-1:500
ICC: 1:500
WB Brain: 1:500-1:1000
IHC: 1:250-1:500
ICC: 1:500
Unconjugated
Does not cross-react with GluA1/GluR1, GluA3/GluR3 or GluA4/GluR4 (based on KO validation results)
Each new lot of antibody is quality control tested by Western blot on rat brain membrane fraction and confirmed to stain the expected molecular weight band.
These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.
United States
24 months from date of receipt
Glutamate receptor 2 (GluR-2) (AMPA-selective glutamate receptor 2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (GluA2)
Shipped on ice packs

