Recombinant Mouse IFN gamma

Name: Recombinant Mouse IFN gamma
Brand: ImmunoChemistry Technologies
SKU: 6504
Price: 200.0 USD
Availability: InStock

IFN-gamma, or type II interferon, is a cytokine that is critical for innate and adaptive immunity against viral and intracellular bacterial infections and for tumor control. Mouse IFN gamma Recombinant Protein is purified IFN gamma produced in yeast.

Click on image to zoom

Go to Full Product Details

SKU: 6504

Volume: 5 µg

Variant

Price:

$200.00

Quantity:

Ships: 1-2 business days

Product Details

Scientific Background

Interferon-gamma (IFN-gamma) is a dimerized soluble cytokine that is the only member of the type II class of interferons. This interferon was originally called macrophage-activating factor, a term now used to describe a larger family of proteins to which IFN-gamma belongs. IFN-gamma, or type II interferon, is a cytokine that is critical for innate and adaptive immunity against viral and intracellular bacterial infections and for tumor control. Aberrant IFN-gamma expression is associated with a number of autoinflammatory and autoimmune diseases. The importance of IFN-gamma in the immune system stems in part from its ability to inhibit viral replication directly, but, most important, derives from its immunostimulatory and immunomodulatory effects. IFN-gamma is produced predominantly by natural killer (NK) and natural killer T (NKT) cells as part of the innate immune response, and by CD4 and CD8 cytotoxic T lymphocyte (CTL) effector T cells once antigen-specific immunity develops.

Format

Lyophilized

Protein Sequence

HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLK DNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLL PESSLRKRKRSRC (133)

Source

Yeast

Contents

Recombinant proteins produced in yeast

Usage Statement

For research use only. Not for use in diagnostic procedures.

Country of Origin

United States

Storage

-20°C

Shipping

Ships at ambient temperature, Domestic: Overnight Delivery; International: Priority Shipping

The Mouse IFN gamma protein can be used in cell culture, as an IFN gamma ELISA Standard, and as a Western Blot Control.

Recover password

Create my account

Recombinant Mouse IFN gamma

SKU: 6504

Product Details

Bulk Order Recombinant Mouse IFN gamma

Related Products

Recently Viewed