Anti-GluA2/GluR2 Glutamate Receptor Antibody FL550 Conjugate (L21/32)
Our Anti-GluA2/GluR2 glutamate receptor mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone L21/32. It is KO validated, detects human, mouse, and rat GluA2/GluR2 glutamate receptor, and is purified by Protein A chromatography. It is great for use in IHC, ICC.
Human, Mouse, Rat
ICC, IHC
Mouse

SKU: 75-002-FL550
Ships: 1-5 business days
Product Details
GluA2/GluR2 glutamate receptor
Glutelin type-A 2 (GluA2) , also called GRIA2, GLUR2, GLURB, GluA2, GluR-K2, HBGR2 or glutamate ionotropic receptor AMPA type subunit 2, is a member of the Glutamate receptor family of the mammalian brain. This neurotransmiter receptor subunit, which is activated during normal central nervous system fuction, is encoded by the GRIA2 (or GLUR2) gene. GluA2 constitutes a key subunit that regulates AMPA receptors. AMPA receptors lacking of Glua2 have been shown to be present in diseased brains, whose basic fuctions have been altered.
Purified by Protein A chromatography
0.5 mg/mL
Monoclonal
L21/32
IgG1
ICC, IHC
Mouse
Gria2 Glur2
90 kDa
Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 produced recombinantly in E. Coli
Rat
Human, Mouse, Rat
AB_2939069
Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
Liquid
Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography and conjugation of purified mAb. Purified mAbs are >90% specific antibody.
PBS with 0.09% azide
FL550 Ex: 550 nm, Em: 575 nm
Does not cross-react with GluA1/GluR1, GluA3/GluR3 or GluA4/GluR4 (based on KO validation results)
Each new lot of antibody is quality control tested by western blot on rat whole brain lysate and confirmed to stain the expected molecular weight band.
These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.
United States
12 months from date of receipt
Glutamate receptor 2 (GluR-2) (AMPA-selective glutamate receptor 2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (GluA2)
Shipped on ice packs