Anti-SUR2A Antibody (BSA and Azide free) (N319A/14)
Our carrier-free Anti-SUR2A mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N319A/14. It is KO validated, detects mouse and rat SUR2A, and is purified by Protein A chromatography. It is great for use in IHC, ICC, WB.
                      Mouse, Rat
                    
                  
                      ELISA, ICC, IHC, WB
                    
                  
                      Mouse
                    
                   KO Validated
                        KO Validated
                      
                      SKU: 75-296-CF
Ships: 1-5 business days
Product Details
                        SUR2A
                      
                    
                        Sulfonylurea receptor 2A (SUR2A), or ATP binding cassette transporter subfamily C member 9 is encoded by the gene ABCC9 and is a member of the ABC transporter super family. Differential splicing of the ABCC9 gene produces 2 isoforms, SUR2A and SUR2B. SUR2A forms cardiac and smooth muscle-type KATP channels with KCNJ11(Kir6.2) and is involved in regulation and activation. Diseases associated with this gene include Cantu Syndrome and Dilated Cardiomyopathy 1O.
                      
                    
                        Purified by Protein A chromatography
                      
                    
                        1 mg/mL
                      
                    
                        Monoclonal
                      
                    
                        N319A/14
                      
                    
                        IgG2a
                      
                    
                        ELISA, ICC, IHC, WB
                      
                    
                        Mouse
                      
                    
                        Abcc9 Sur2
                      
                    
                        120 kDa
                      
                    
                        Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A (accession number P70170) produced recombinantly in E. Coli
                      
                    
                        Mouse
                      
                    
                        Mouse, Rat
                      
                    
                        Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
                      
                    
                        Liquid
                      
                    
                        Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography and buffer exchanged into 1X PBS. Purified mAbs are >90% specific antibody.
                      
                    
                        PBS
                      
                    
                        Unconjugated
                      
                    
                        Does not cross-react with SUR2B
                      
                    
                        Each new lot of antibody is quality control tested on cells overexpressing target protein and confirmed to give the expected staining pattern.
                      
                    
                        These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.
                      
                    
                        United States
                      
                    
                        12 months from date of receipt
                      
                    
                        ATP-binding cassette sub-family C member 9 (Sulfonylurea receptor 2)
                      
                    
                        Shipped on ice packs
                      
                    
 
                 
                