Anti-SUR2A Antibody FL490 Conjugate (N319A/14)
Our Anti-SUR2A mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N319A/14. It is KO validated, detects mouse and rat SUR2A, and is purified by Protein A chromatography. It is great for use in IHC, ICC.
Mouse, Rat
ICC, IHC
Mouse

SKU: 75-296-FL490
Ships: 1-5 business days
Product Details
SUR2A
Sulfonylurea receptor 2A (SUR2A), or ATP binding cassette transporter subfamily C member 9 is encoded by the gene ABCC9 and is a member of the ABC transporter super family. Differential splicing of the ABCC9 gene produces 2 isoforms, SUR2A and SUR2B. SUR2A forms cardiac and smooth muscle-type KATP channels with KCNJ11(Kir6.2) and is involved in regulation and activation. Diseases associated with this gene include Cantu Syndrome and Dilated Cardiomyopathy 1O.
Purified by Protein A chromatography
0.5 mg/mL
Monoclonal
N319A/14
IgG2a
ICC, IHC
Mouse
Abcc9 Sur2
120 kDa
Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A (accession number P70170) produced recombinantly in E. Coli
Mouse
Mouse, Rat
AB_2940040
Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
Liquid
Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography and conjugation of purified mAb. Purified mAbs are >90% specific antibody.
PBS with 0.09% azide
FL490 Ex: 491 nm, Em: 515 nm
Does not cross-react with SUR2B
Each new lot of antibody is quality control tested on cells overexpressing target protein and confirmed to give the expected staining pattern.
These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.
United States
12 months from date of receipt
ATP-binding cassette sub-family C member 9 (Sulfonylurea receptor 2)
Shipped on ice packs