Recombinant Rat APRIL

Name: Recombinant Rat APRIL
Brand: ImmunoChemistry Technologies
SKU: 6505
Price: 200.0 USD
Availability: InStock

A proliferation-inducing ligand (APRIL), also known as TNFSF13, is a member of the tumor necrosis factor (TNF) ligand superfamily. APRIL/TNFSF13 has been shown to play a role in protecting cells from undergoing apoptosis and promoting B cell development. Rat APRIL Recombinant Protein is purified APRIL (TNFSF13) produced in yeast.

Click on image to zoom

Go to Full Product Details

SKU: 6505

Volume: 5 µg

Variant

Price:

$200.00

Quantity:

Ships: 1-2 business days

Product Details

Scientific Background

A proliferation-inducing ligand (APRIL), also known as TNFSF13, is a member of the tumor necrosis factor (TNF) ligand superfamily. Nineteen cytokine ligands have been identified as part of the TNF family on the basis of sequence, functional, and structural similarities. Family members include TNF beta (TNFSF1), TNF alpha (TNFSF2), Lymphotoxin beta (TNFSF3), OX40 Ligand (TNFSF4), CD40 Ligand (TNFSF5), Fas Ligand (TNFSF6), CD27 Ligand (TNFSF7), CD30 Ligand (TNFSF8), 4-1BB Ligand (TNFSF9), TRAIL (TNFSF10), TRANCE/RANKL (TNFSF11), TWEAK (TNFSF12), APRIL(TNFSF13), BAFF (TNFSF13B), LIGHT (TNFSF14), TL1A/VEGI (TNFSF15), and GITR Ligand (TNFSF18). The TNFSF13 ligand (APRIL) is expressed by macrophages and dendritic cells. APRIL/TNFSF13 has been shown to play a role in protecting cells from undergoing apoptosis and promoting B cell development.

Format

Lyophilized

Protein Sequence

AVLTQKHKKKQSVLHLVPINITSKADSDMTEVMWQPALRRGRGLEAQGDTVRVRDTGIYL LYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIKSMPSDPDRAYNSCYSAGVFHLHQGDI ITVKIPRANAKLSLSPHGTFLGFVKL (146)

Source

Yeast

Contents

Recombinant proteins produced in yeast

Usage Statement

For research use only. Not for use in diagnostic procedures.

Country of Origin

United States

Storage

-20°C

Shipping

Ships at ambient temperature, Domestic: Overnight Delivery; International: Priority Shipping

The Rat APRIL protein can be used in cell culture, such as an APRIL ELISA Standard, and as a Western Blot Control.

Recover password

Create my account

Recombinant Rat APRIL

SKU: 6505

Product Details

Bulk Order Recombinant Rat APRIL

Related Products

Recently Viewed