Anti-SVOP Antibody FL550 Conjugate (N356/23)
Our Anti-SVOP mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N356/23. It is KO validated, detects mouse and rat SVOP, and is purified by Protein A chromatography. It is great for use in ICC.
Mouse, Rat
ICC
Mouse

SKU: 75-353-FL550
Ships: 1-5 business days
Product Details
SVOP
Synaptic vesicle 2-related protein or SVOP is encoded by the gene SVOP. SVOP contains 12 transmembrane regions and has transporter and ion transmembrane transporter activity. SVOP is expressed early in development and expressed in brain and endocrine cells where it is found in synaptic vesicles and microvesicles. Diseases associated with SVOP include Intestinal Botulism and Familial Atrial Fibrillation.
Purified by Protein A chromatography
0.5 mg/mL
Monoclonal
N356/23
IgG1
ICC
Mouse
Svop
60 kDa
Fusion protein amino acids 1-85 (MEEDLFQLRQLPVVKFRRTGESARSEDDAASGEHDVQIEGVRVGLEAVELDDGAAVPKEFANPTDDTFMVEDAVEAIGFGRFQWK, cytoplasmic N-terminus) of rat SVOP (accession number Q9Z2I7) produced recombinantly in E. Coli
Rat
Mouse, Rat
AB_2940185
Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
Liquid
Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography and conjugation of purified mAb. Purified mAbs are >90% specific antibody.
PBS with 0.09% azide
FL550 Ex: 550 nm, Em: 575 nm
Does not cross-react with SVOPL/SVOP2
Each new lot of antibody is quality control tested by western blot on rat whole brain lysate and confirmed to stain the expected molecular weight band.
These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.
United States
12 months from date of receipt
Synaptic vesicle 2-related protein (SV2-related protein)
Shipped on ice packs