Anti-REEP1 Antibody (BSA and Azide free) (N345/51)
Our carrier-free Anti-REEP1 mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N345/51. It detects mouse and rat REEP1, and is purified by Protein A chromatography. It is great for use in IHC, ICC, WB.
                      Mouse, Rat
                    
                  
                      ELISA, ICC, IHC, WB
                    
                  
                      Mouse
                    
                  SKU: 75-313-CF
Ships: 1-5 business days
Product Details
                        REEP1
                      
                    
                        Receptor expression-enhancing protein 1, Receptor Accessory Protein 1 or REEP1 is encoded by the gene REEP1. The REEP protein family is made up of six REEP proteins 1-6. REEP1 is a mitochondrial protein that links ER tubules to the cytoskeleton and is involved in ER formation and remodeling. REEP1 is expressed in brain, spinal cord and testes. It is also expressed in olfactory sensory neurons and may play a role in the cell surface expression of odorant receptors. Diseases associated with this gene include Spastic Paraplegia distal hereditary motor neuropathy type V. Ref: Brain Res. 2014 January 30; 1545: 12–22. doi:10.1016/j.brainres.2013.12.008
                      
                    
                        Purified by Protein A chromatography
                      
                    
                        1 mg/mL
                      
                    
                        Monoclonal
                      
                    
                        N345/51
                      
                    
                        IgG2b
                      
                    
                        ELISA, ICC, IHC, WB
                      
                    
                        Mouse
                      
                    
                        Reep1 D6Ertd253e C2orf23 SPG31
                      
                    
                        22 kDa
                      
                    
                        Fusion protein amino acids 111-201 (KDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGTGRSSGKHSQPKMSRSASESAGSSGTA, cytoplasmic C-terminus) of mouse REEP1 (accession number Q8BGH4) produced recombinantly in E. Coli
                      
                    
                        Mouse
                      
                    
                        Mouse, Rat
                      
                    
                        Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
                      
                    
                        Liquid
                      
                    
                        Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography and buffer exchanged into 1X PBS. Purified mAbs are >90% specific antibody.
                      
                    
                        PBS
                      
                    
                        Unconjugated
                      
                    
                        Does not cross-react with REEP2
                      
                    
                        Each new lot of antibody is quality control tested by western blot on rat whole brain lysate and confirmed to stain the expected molecular weight band.
                      
                    
                        These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.
                      
                    
                        United States
                      
                    
                        12 months from date of receipt
                      
                    
                        Receptor expression-enhancing protein 1 (Spastic paraplegia 31 protein)
                      
                    
                        Shipped on ice packs
                      
                    
 
                 
                