Products: Primary Antibodies

Anti-REEP1 (N345/51)

 Download Full Datasheet


Catalog # Option Volume Concentration Price*
Catalog #
100 µL
1 mg/mL
Catalog #
TC Supernatant
5 mL
Lot dependent

Validation Images




Antibody Type:


Host Species:


Antibody Isotype:


Species Reactivity:

Mouse Rat

WB Western Blot
IHC Immunohistochemistry
ICC Immunocytochemistry
IP Immunoprecipitation
AT Array Tomography
EM Electron Microscopy
CHIP Chromatin Immunoprecipitation
DB Dot Blot



Fusion protein amino acids 111-201 (KDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGTGRSSGKHSQPKMSRSASESAGSSGTA, cytoplasmic C-terminus) of mouse REEP1 (also known as Receptor expression-enhancing protein 1, C2orf23, D6Ertd253e and rCG_56072, accession number Q8BGH4) Rat: 97% identity (89/91 amino acids identical) Human: 95% identity (87/91 amino acids identical) Some identity with REEP2

Cross Reactivity:

Does not cross-react with REEP2

Protein Name(s):

Receptor expression-enhancing protein 1 (Spastic paraplegia 31 protein)

Gene Name(s):

Reep1 D6Ertd253e C2orf23 SPG31

Antibody Registry ID:

Purified: AB_2315913
TC Supernatant: AB_2315912

Antibody Validation and Application Notes

This antibody has been validated using the following assays:
Western Blot:

This antibody recognizes a single immunoreactive band of expected molecular weight when used to probe lysate from COS cells overexpressing target.

This antibody recognizes a single immunoreactive band of expected molecularweight when used to probe brain lysate.


This antibody shows the expected staining pattern when used to stain COS cells overexpressing target.

Molecular Weight:

22 kDa

Quality Control

The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.

Each new lot of this antibody is tested to confirm that it recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.

Citations and References