NOTICE: Deliveries are being delayed all across the US. Expect longer than normal shipping times.

Products: Primary Antibodies

Anti-REEP1 Antibody (N345/51)

NeuroMab Logo from NeuroMab



Brand Catalog # Option Volume Concentration Price
NeuroMab Logo
Catalog #
100 µL
1 mg/mL
NeuroMab Logo
Catalog #
TC Supernatant
5 mL
Lot dependent

Validation Images

Product Details

Antibody Type:


Host Species:


Antibody Isotype:


Species Reactivity:

Mouse Rat

WB Western Blot
IHC Immunohistochemistry
ICC Immunocytochemistry
IP Immunoprecipitation
AT Array Tomography
EM Electron Microscopy
CHIP Chromatin Immunoprecipitation
DB Dot Blot


Target Description:

Receptor expression-enhancing protein 1, Receptor Accessory Protein 1 or REEP1 is encoded by the gene REEP1. The REEP protein family is made up of six REEP proteins 1-6. REEP1 is a mitochondrial protein that links ER tubules to the cytoskeleton and is involved in ER formation and remodeling. REEP1 is expressed in brain, spinal cord and testes. It is also expressed in olfactory sensory neurons and may play a role in the cell surface expression of odorant receptors. Diseases associated with this gene include Spastic Paraplegia distal hereditary motor neuropathy type V. Ref: Brain Res. 2014 January 30; 1545: 12–22. doi:10.1016/j.brainres.2013.12.008


Fusion protein amino acids 111-201 (KDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGTGRSSGKHSQPKMSRSASESAGSSGTA, cytoplasmic C-terminus) of mouse REEP1 (also known as Receptor expression-enhancing protein 1, C2orf23, D6Ertd253e and rCG_56072, accession number Q8BGH4) Rat: 97% identity (89/91 amino acids identical) Human: 95% identity (87/91 amino acids identical) Some identity with REEP2

Cross Reactivity:

Does not cross-react with REEP2

Protein Name(s):

Receptor expression-enhancing protein 1 (Spastic paraplegia 31 protein)

Gene Name(s):

Reep1 D6Ertd253e C2orf23 SPG31

Antibody Registry ID:

Purified: AB_2315913
TC Supernatant: AB_2315912

Antibody Validation and Application Notes

This antibody has been validated using the following assays:
Western Blot:

This antibody recognizes a single immunoreactive band of expected molecular weight when used to probe lysate from COS cells overexpressing target.

This antibody recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.


This antibody shows the expected staining pattern when used to stain COS cells overexpressing target.

Molecular Weight:

22 kDa

Quality Control

The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.

Each new lot of this antibody is tested to confirm that it recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.

Citations and References