Products: Primary Antibodies
PRODUCT OPTIONS
Brand | Catalog # | Option | Volume | Concentration | Price | |
---|---|---|---|---|---|---|
Brand![]() |
Catalog # 75-313 |
Option Purified |
Volume 100 µL |
Concentration 1 mg/mL |
Price $285.00 |
|
Brand![]() |
Catalog # 73-313 |
Option TC Supernatant |
Volume 5 mL |
Concentration Lot dependent |
Price $285.00 |
Product Details
Monoclonal
Mouse
IgG2b
Mouse Rat
ICC IHC WB
Receptor expression-enhancing protein 1, Receptor Accessory Protein 1 or REEP1 is encoded by the gene REEP1. The REEP protein family is made up of six REEP proteins 1-6. REEP1 is a mitochondrial protein that links ER tubules to the cytoskeleton and is involved in ER formation and remodeling. REEP1 is expressed in brain, spinal cord and testes. It is also expressed in olfactory sensory neurons and may play a role in the cell surface expression of odorant receptors. Diseases associated with this gene include Spastic Paraplegia distal hereditary motor neuropathy type V. Ref: Brain Res. 2014 January 30; 1545: 12–22. doi:10.1016/j.brainres.2013.12.008
Fusion protein amino acids 111-201 (KDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGTGRSSGKHSQPKMSRSASESAGSSGTA, cytoplasmic C-terminus) of mouse REEP1 (also known as Receptor expression-enhancing protein 1, C2orf23, D6Ertd253e and rCG_56072, accession number Q8BGH4) Rat: 97% identity (89/91 amino acids identical) Human: 95% identity (87/91 amino acids identical) Some identity with REEP2
Does not cross-react with REEP2
Receptor expression-enhancing protein 1 (Spastic paraplegia 31 protein)
Reep1 D6Ertd253e C2orf23 SPG31
Purified: AB_2315913
TC Supernatant: AB_2315912
Antibody Validation and Application Notes
This antibody has been validated using the following assays:
This antibody recognizes a single immunoreactive band of expected molecular weight when used to probe lysate from COS cells overexpressing target.
This antibody recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.
This antibody shows the expected staining pattern when used to stain COS cells overexpressing target.
22 kDa
Quality Control
The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.
Each new lot of this antibody is tested to confirm that it recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.
Citations and References
- Hurt CM#1, Björk S#1,2, Ho VK1, Gilsbach R3, Hein L3, Angelotti T1.. (2014), 'REEP1 and REEP2 proteins are preferentially expressed in neuronal and neuronal-like exocytotic tissues..' Brain Res. . 10.1016/j.brainres.2013.12.008.