Recombinant Mouse IL-1 beta

Name: Recombinant Mouse IL-1 beta
Brand: ImmunoChemistry Technologies
SKU: 6489
Price: 200.0 USD
Availability: InStock

IL-1 beta (IL-1β) is a member of the interleukin 1 family of cytokines. The IL-1 beta cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. Mouse IL-1 beta Recombinant Protein is purified interleukin-1 beta cytokine produced in yeast.

Click on image to zoom

Go to Full Product Details

SKU: 6489

Volume: 5 µg

Variant

Price:

$200.00

Quantity:

Ships: 1-2 business days

Product Details

Scientific Background

IL-1β is a member of the interleukin 1 family of cytokines. The IL-1 family of cytokines encompasses eleven proteins that each share a similar β-barrel structure and bind to Ig-like receptors. Several of the well characterized members of the IL-1 cytokines play key roles in the development and regulation of inflammation. IL-1α (IL-1F1), IL-1β (IL-1F2), and IL-18 (IL-1F4) are well-known inflammatory cytokines active in the initiation of the inflammatory reaction and in driving Th1 and Th17 inflammatory responses. In contrast, IL-1 receptor antagonist (IL-1ra; IL-1F3) and IL-36 receptor antagonist (IL-36ra; IL-1F5) reduce inflammation by blocking the binding of the agonist receptor ligands. IL-33 (IL-1F11) is thought to function as an ‘alarmin’ released following cell necrosis to alerting the immune system to tissue damage or stress. The biological properties of IL-37 (IL-1F7) are mainly those of down-regulating inflammation. The IL-1 beta (IL-1β) cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis.

Format

Lyophilized

Protein Sequence

VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVAL GLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNW YISTSQAEHKPVFLGNNSGQDIIDFTMESVSS (152)

Source

Yeast

Contents

Recombinant proteins produced in yeast

Usage Statement

For research use only. Not for use in diagnostic procedures.

Country of Origin

United States

Storage

-20°C

Shipping

Ships at ambient temperature, Domestic: Overnight Delivery; International: Priority Shipping

The Mouse IL-1 beta protein can be used in cell culture, as an IL-1 beta ELISA Standard, and as a Western Blot Control.

Recover password

Create my account

Recombinant Mouse IL-1 beta

SKU: 6489

Product Details

Bulk Order Recombinant Mouse IL-1 beta

Related Products

Recently Viewed