Products: Primary Antibodies
PRODUCT OPTIONS
Brand | Catalog # | Option | Volume | Concentration | Price | |
---|---|---|---|---|---|---|
Brand![]() |
Catalog # 73-399 |
Option TC Supernatant |
Volume 5 mL |
Concentration Lot dependent |
Price $285.00 |
Product Details
Monoclonal
Mouse
IgG2b
Human Mouse Rat
ICC IHC WB
Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRA DM, cytoplasmic C-terminus) of rat SUR2B (also known as Sulfonylurea receptor 2B, ATPbinding cassette transporter sub-family C member 9B and Abcc9B, accession number Q63563-2)
Mouse: 100% identity (43/43 amino acids identical)
Human: 97% identity (42/43 amino acids identical)
No identity with SUR2A
75% identity with SUR1
Does not cross-react with SUR1
ATP-binding cassette sub-family C member 9 (Sulfonylurea receptor 2)
Abcc9 Sur2
TC Supernatant: AB_2341102
Antibody Validation and Application Notes
This antibody has been validated using the following assays:
This antibody recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.
This antibody shows the expected staining pattern when used to stain COS cells overexpressing target.
175 kDa (and smaller fragments likely due to proteolytic cleavage)
Quality Control
The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.
Each new lot of this antibody is tested to confirm that it shows the expected staining pattern when used to stain COS cells overexpressing target.