Products: Primary Antibodies

Anti-SUR2B (N323B/20)

NeuroMab Logo from NeuroMab



Brand Catalog # Option Volume Concentration Price
NeuroMab Logo
Catalog #
TC Supernatant
5 mL
Lot dependent




Antibody Type:


Host Species:


Antibody Isotype:


Species Reactivity:

Human Mouse Rat

WB Western Blot
IHC Immunohistochemistry
ICC Immunocytochemistry
IP Immunoprecipitation
AT Array Tomography
EM Electron Microscopy
CHIP Chromatin Immunoprecipitation
DB Dot Blot



Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRA DM, cytoplasmic C-terminus) of rat SUR2B (also known as Sulfonylurea receptor 2B, ATPbinding cassette transporter sub-family C member 9B and Abcc9B, accession number Q63563-2)
Mouse: 100% identity (43/43 amino acids identical)
Human: 97% identity (42/43 amino acids identical)
No identity with SUR2A
75% identity with SUR1

Cross Reactivity:

Does not cross-react with SUR1

Protein Name(s):

ATP-binding cassette sub-family C member 9 (Sulfonylurea receptor 2)

Gene Name(s):

Abcc9 Sur2

Antibody Registry ID:

TC Supernatant: AB_2341102

Antibody Validation and Application Notes

This antibody has been validated using the following assays:
Western Blot:

This antibody recognizes a single immunoreactive band of expected molecularweight when used to probe brain lysate.


This antibody shows the expected staining pattern when used to stain COS cells overexpressing target.

This antibody shows the expected immunoperoxidase-diaminobenzidine/immunofluorescence staining pattern when used to stain brain sections.

Molecular Weight:

175 kDa (and smaller fragments likely due to proteolytic cleavage)

Quality Control

The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.

Each new lot of this antibody is tested to confirm that it shows the expected staining pattern when used to stain COS cells overexpressing target.