Products: Primary Antibodies
PRODUCT OPTIONS
Brand | Catalog # | Option | Volume | Concentration | Price | |
---|---|---|---|---|---|---|
Brand![]() |
Catalog # 73-373 |
Option TC Supernatant |
Volume 5 mL |
Concentration Lot dependent |
Price $285.00 |
Product Details
Monoclonal
Mouse
IgG1
Human Mouse Rat
ICC IHC WB
Fusion protein amino acids 1-173 (MSKRTSSDTPLGRVSGAAFPSPTASEMAEISRIQYEMEYTEGIS QRMRVPEKLKVAPPNADLEQGFQEGVPNASVIMQVPERIVVAGNNEDVSFSRPADLDLIQS TPFKPLALKTPPRVLTLSERPLDFLDLERPPVTPQNEEIRAVGRLKRERSMSENAVRQNGQL VRNDSV, cytoplasmic N-terminal exons 1, 2, 3 and 4) and 272-322 (YGISNIEATIEGTSDDM TVVDAASLRRQIIKLNRRLQLLEEENKERAKREM, cytoplasmic N-terminal exons 8 and most of 9) of mostly human MFF (also known as Mitochondrial fission factor, C2orf33, AD030, AD033 and GL004, accession number Q9GZY8) Human: 96% identity (167/173 amino acids identical) and 94% identity (48/51 amino acids identical) Rat: 95% identity (141/147 amino acids identical) and 92% identity (47/51 amino acids identical) Mouse: 93% identity (138/147 amino acids identical) and 84% identity (43/51 amino acids identical)
Does not react with MFF isoforms that do not contain exon 1
Mitochondrial fission factor
MFF C2orf33 AD030 AD033 GL004
TC Supernatant: AB_2315892
Antibody Validation and Application Notes
This antibody has been validated using the following assays:
This antibody has been knockout-validated in mouse brain (by Western blot and/or immunohistochemistry).
This antibody recognizes a single immunoreactive band of expected molecular weight when used to probe lysate from COS cells overexpressing target.
This antibody recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.
This antibody shows the expected staining pattern when used to stain COS cells overexpressing target.
40 kDa
Quality Control
The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.
Each new lot of this antibody is tested to confirm that it shows the expected immunoperoxidase-diaminobenzidine / immunofluorescence staining pattern when used to stain brain sections.