Products: Primary Antibodies

Anti-MFF (exon 1) Antibody (N382/69)

NeuroMab Logo from NeuroMab



Brand Catalog # Option Volume Concentration Price
NeuroMab Logo
Catalog #
TC Supernatant
5 mL
Lot dependent

Validation Images

Product Details

Antibody Type:


Host Species:


Antibody Isotype:


Species Reactivity:

Human Mouse Rat

WB Western Blot
IHC Immunohistochemistry
ICC Immunocytochemistry
IP Immunoprecipitation
AT Array Tomography
EM Electron Microscopy
CHIP Chromatin Immunoprecipitation
DB Dot Blot



Fusion protein amino acids 1-173 (MSKRTSSDTPLGRVSGAAFPSPTASEMAEISRIQYEMEYTEGIS QRMRVPEKLKVAPPNADLEQGFQEGVPNASVIMQVPERIVVAGNNEDVSFSRPADLDLIQS TPFKPLALKTPPRVLTLSERPLDFLDLERPPVTPQNEEIRAVGRLKRERSMSENAVRQNGQL VRNDSV, cytoplasmic N-terminal exons 1, 2, 3 and 4) and 272-322 (YGISNIEATIEGTSDDM TVVDAASLRRQIIKLNRRLQLLEEENKERAKREM, cytoplasmic N-terminal exons 8 and most of 9) of mostly human MFF (also known as Mitochondrial fission factor, C2orf33, AD030, AD033 and GL004, accession number Q9GZY8) Human: 96% identity (167/173 amino acids identical) and 94% identity (48/51 amino acids identical) Rat: 95% identity (141/147 amino acids identical) and 92% identity (47/51 amino acids identical) Mouse: 93% identity (138/147 amino acids identical) and 84% identity (43/51 amino acids identical)

Cross Reactivity:

Does not react with MFF isoforms that do not contain exon 1

Protein Name(s):

Mitochondrial fission factor

Gene Name(s):

MFF C2orf33 AD030 AD033 GL004

Antibody Registry ID:

TC Supernatant: AB_2315892

Antibody Validation and Application Notes

This antibody has been validated using the following assays:
Knockout Validation:

This antibody has been knockout-validated in mouse brain (by Western blot and/or immunohistochemistry).

Western Blot:

This antibody recognizes a single immunoreactive band of expected molecular weight when used to probe lysate from COS cells overexpressing target.

This antibody recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.


This antibody shows the expected staining pattern when used to stain COS cells overexpressing target.

This antibody shows the expected immunoperoxidase-diaminobenzidine / immunofluorescence staining pattern when used to stain brain sections.

Molecular Weight:

40 kDa

Quality Control

The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.

Each new lot of this antibody is tested to confirm that it shows the expected immunoperoxidase-diaminobenzidine / immunofluorescence staining pattern when used to stain brain sections.